KEGG   Homo sapiens (human): 4123Help
Entry
4123              CDS       T01001                                 

Gene name
MAN2C1, MAN6A8, MANA, MANA1
Definition
(RefSeq) mannosidase alpha class 2C member 1
  KO
K01191  
alpha-mannosidase [EC:3.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4123 (MAN2C1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     4123 (MAN2C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q24.2
AA seq 1040 aa AA seqDB search
MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAV
QRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLT
KEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAV
FHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASR
FFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQA
QQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQE
FGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRV
LVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLS
NTDGLPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGNRECERIL
HDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAMCHYEDIR
SHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRIEVMALPKPGGAHSLALVTVPSMGYA
PVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASGREAIAEG
AVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISPN
SRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYN
TSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTG
RHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETV
KQAESSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDNRLK
LTFSPFQVLSLLLVLQPPPH
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgccggccttgaagcactggcgcaccacgctggagcgggtggagaagttc
gtgtcgccgctctactttaccgactgtaacctccgcggcaggctttttggggccagctgc
cctgtggctgtgctctccagcttcctgacgccggagagacttccctaccaggaggcagtc
cagcgggacttccgccccgcgcaggtcggcgacagcttcggacccacatggtggacctgc
tggttccgggtggagctgaccatcccagaggcatgggtgggccaggaagttcacctttgc
tgggaaagtgatggagaaggtctggtgtggcgtgatggagaacctgtccagggtttaacc
aaagagggtgagaagaccagctatgtcctgactgacaggctgggggaaagagacccccga
agcctcactctctatgtggaagtagcctgcaatgggctcctgggggccgggaagggaagc
atgattgcagcccctgaccctgagaagatgttccagctgagccgggctgagctagctgtg
ttccaccgggatgtccacatgctcctggtggatctggagctgctgctgggcatagccaag
ggcctcgggaaggacaaccagcgcagcttccaggccctgtacacagccaatcagatggtg
aacgtgtgtgaccctgcccagcccgagaccttcccagtggcccaggccctggcctccagg
ttctttggccaacatgggggtgaaagccaacacaccattcatgccacagggcactgccac
attgatacagcctggctttggcccttcaaagagactgtgaggaaatgtgcccggagctgg
gtgaccgccctgcagctcatggagcggaaccctgagttcatctttgcctgctcccaggcg
cagcagctggaatgggtgaagagccgctaccctggcctgtactcccgcatccaggagttt
gcgtgccgtgggcagtttgtgcctgtggggggcacctgggtggagatggatgggaacctg
cccagtggagaggccatggtgaggcagtttttgcagggccagaacttctttctgcaggag
tttgggaagatgtgctctgagttctggctgccggacacctttggctactcagcacagctc
ccccagatcatgcacggctgtggcatcaggcgctttctcacccagaaattgagctggaat
ttggtgaactccttcccacaccatacatttttctgggagggcctggatggctcccgtgta
ctggtccacttcccacctggcgactcctatgggatgcagggcagcgtggaggaggtgctg
aagaccgtggccaacaaccgggacaaggggcgggccaaccacagtgccttcctctttggc
tttggggatgggggtggtggccccacccagaccatgctggaccgcctgaagcgcctgagc
aatacggatgggctgcccagggtgcagctatcttctccaagacagctcttctcagcactg
gagagtgactcagagcagctgtgcacgtgggttggggagctcttcttggagctgcacaat
ggcacatacaccacccatgcccagatcaagaaggggaaccgggaatgtgagcggatcctg
cacgacgtggagctgctcagtagcctggccctggcccgcagtgcccagttcctataccca
gcagcccagctgcagcacctctggaggctccttcttctgaaccagttccatgatgtggtg
actggaagctgcatccagatggtggcagaggaagccatgtgccattatgaagacatccgt
tcccatggcaatacactgctcagcgctgcagccgcagccctgtgtgctggggagccaggt
cctgagggcctcctcatcgtcaacacactgccctggaagcggatcgaagtgatggccctg
cccaaaccgggcggggcccacagcctagccctggtgacagtgcccagcatgggctatgct
cctgttcctccccccacctcactgcagcccctgctgccccagcagcctgtgttcgtagtg
caagagactgatggctccgtgactctggacaatggcatcatccgagtgaagctggaccca
actggtcgcctgacgtccttggtcctggtggcctctggcagggaggccattgctgagggc
gccgtggggaaccagtttgtgctatttgatgatgtccccttgtactgggatgcatgggac
gtcatggactaccacctggagacacggaagcctgtgctgggccaggcagggaccctggca
gtgggcaccgagggcggcctgcggggcagcgcctggttcttgctacagatcagccccaac
agtcggcttagccaggaggttgtgctggacgttggctgcccctatgtccgcttccacacc
gaggtacactggcatgaggcccacaagttcctgaaggtggagttccctgctcgcgtgcgg
agttcccaggccacctatgagatccagtttgggcacctgcagcgacctacccactacaat
acctcttgggactgggctcgatttgaggtgtgggcccatcgctggatggatctgtcagaa
cacggctttgggctggccctgctcaacgactgcaagtatggcgcgtcagtgcgaggcagc
atcctcagcctctcgctcttgcgggcgcctaaagccccggacgctactgctgacacgggg
cgccacgagttcacctatgcactgatgccgcacaagggctctttccaggatgctggcgtt
atccaagctgcctacagcctaaacttccccctgttggctctgccagcccccagcccagcg
cccgccacctcctggagtgcgttttccgtgtcttcacccgcggtcgtattggagaccgtc
aagcaggcggagagcagcccccagcgccgctcgctggtcctgaggctgtatgaggcccac
ggcagccacgtggactgctggctgcacttgtcgctgccggttcaggaggccatcctctgc
gatctcttggagcgaccagaccctgctggccacttgacccttcgggacaaccgcctgaag
ctcaccttttctcccttccaagtgctgtccctgttgctcgtgcttcagcctccgccacac
tga

DBGET integrated database retrieval system