KEGG   Homo sapiens (human): 4125Help
Entry
4125              CDS       T01001                                 

Gene name
MAN2B1, LAMAN, MANB
Definition
mannosidase, alpha, class 2B, member 1 (EC:3.2.1.24)
Orthology
K12311  
lysosomal alpha-mannosidase [EC:3.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Lysosome
Disease
H00139  
alpha-Mannosidosis
H00422  
Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4125 (MAN2B1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    4125 (MAN2B1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     4125 (MAN2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 1011 aa AA seqDB search
MGAYARASGVCARGCLDSAGPWTMSRALRPPLPPLCFFLLLLAAAGARAGGYETCPTVQP
NMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQYILDSVISALLADPTRRFIYVE
IAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLRFLE
DTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVRMQKLEMEQVWR
ASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVDYFLNVA
TAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQAKGSSVHVLYSTPACYL
WELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
LAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLLSNAL
ARLRGFKDHFTFCQQLNISICPLSQTAARFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDP
NGRTVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPIPRRS
WSPALTIENEHIRATFDPDTGLLMEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAY
IFRPNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIP
VGDTWGKEVISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLNQTEPVAGNYYPVNT
RIYITDGNMQLTVLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMENGSGAWVRG
RHLVLLDTAQAAAAGHRLLAEQEVLAPQVVLAPGGGAAYNLGAPPRTQFSGLRRDLPPSV
HLLTLASWGPEMVLLRLEHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQ
LREAASRLKWTTNTGPTPHQTPYQLDPANITLEPMEIRTFLASVQWKEVDG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctacgcgcgggcttcgggggtctgcgctcgcggctgcctggactcagcaggc
ccctggaccatgtcccgcgccctgcggccaccgctcccgcctctctgctttttccttttg
ttgctggcggctgccggtgctcgggccgggggatacgagacatgccccacagtgcagccg
aacatgctgaacgtgcacctgctgcctcacacacatgatgacgtgggctggctcaaaacc
gtggaccagtacttttatggaatcaagaatgacatccagcacgccggtgtgcagtacatc
ctggactcggtcatctctgccttgctggcagatcccacccgtcgcttcatttacgtggag
attgccttcttctcccgttggtggcaccagcagacaaatgccacacaggaagtcgtgcga
gaccttgtgcgccaggggcgcctggagttcgccaatggtggctgggtgatgaacgatgag
gcagccacccactacggtgccatcgtggaccagatgacacttgggctgcgctttctggag
gacacatttggcaatgatgggcgaccccgtgtggcctggcacattgaccccttcggccac
tctcgggagcaggcctcgctgtttgcgcagatgggcttcgacggcttcttctttgggcgc
cttgattatcaagataagtgggtacggatgcagaagctggagatggagcaggtgtggcgg
gccagcaccagcctgaagcccccgaccgcggacctcttcactggtgtgcttcccaatggt
tacaacccgccaaggaatctgtgctgggatgtgctgtgtgtcgatcagccgctggtggag
gaccctcgcagccccgagtacaacgccaaggagctggtcgattacttcctaaatgtggcc
actgcccagggccggtattaccgcaccaaccacactgtgatgaccatgggctcggacttc
caatatgagaatgccaacatgtggttcaagaaccttgacaagctcatccggctggtaaat
gcgcagcaggcaaaaggaagcagtgtccatgttctctactccacccccgcttgttacctc
tgggagctgaacaaggccaacctcacctggtcagtgaaacatgacgacttcttcccttac
gcggatggcccccaccagttctggaccggttacttttccagtcggccggccctcaaacgc
tacgagcgcctcagctacaacttcctgcaggtgtgcaaccagctggaggcgctggtgggc
ctggcggccaacgtgggaccctatggctccggagacagtgcacccctcaatgaggcgatg
gctgtgctccagcatcacgacgccgtcagcggcacctcccgccagcacgtggccaacgac
tacgcgcgccagcttgcggcaggctgggggccttgcgaggttcttctgagcaacgcgctg
gcgcggctcagaggcttcaaagatcacttcaccttttgccaacagctaaacatcagcatc
tgcccgctcagccagacggcggcgcgcttccaggtcatcgtttataatcccctggggcgg
aaggtgaattggatggtacggctgccggtcagcgaaggcgttttcgttgtgaaggacccc
aatggcaggacagtgcccagcgatgtggtaatatttcccagctcagacagccaggcgcac
cctccggagctgctgttctcagcctcactgcccgccctgggcttcagcacctattcagta
gcccaggtgcctcgctggaagccccaggcccgcgcaccacagcccatccccagaagatcc
tggtcccctgctttaaccatcgaaaatgagcacatccgggcaacgtttgatcctgacaca
gggctgttgatggagattatgaacatgaatcagcaactcctgctgcctgttcgccagacc
ttcttctggtacaacgccagtataggtgacaacgaaagtgaccaggcctcaggtgcctac
atcttcagacccaaccaacagaaaccgctgcctgtgagccgctgggctcagatccacctg
gtgaagacacccttggtgcaggaggtgcaccagaacttctcagcttggtgttcccaggtg
gttcgcctgtacccaggacagcggcacctggagctagagtggtcggtggggccgatacct
gtgggcgacacctgggggaaggaggtcatcagccgttttgacacaccgctggagacaaag
ggacgcttctacacagacagcaatggccgggagatcctggagaggaggcgggattatcga
cccacctggaaactgaaccagacggagcccgtggcaggaaactactatccagtcaacacc
cggatttacatcacggatggaaacatgcagctgactgtgctgactgaccgctcccagggg
ggcagcagcctgagagatggctcgctggagctcatggtgcaccgaaggctgctgaaggac
gatggacgcggagtatcggagccactaatggagaacgggtcgggggcgtgggtgcgaggg
cgccacctggtgctgctggacacagcccaggctgcagccgccggacaccggctcctggcg
gagcaggaggtcctggcccctcaggtggtgctggccccgggtggcggcgccgcctacaat
ctcggggctcctccgcgcacgcagttctcagggctgcgcagggacctgccgccctcggtg
cacctgctcacgctggccagctggggccccgaaatggtgctgctgcgcttggagcaccag
tttgccgtaggagaggattccggacgtaacctgagcgcccccgttaccttgaacttgagg
gacctgttctccaccttcaccatcacccgcctgcaggagaccacgctggtggccaaccag
ctccgcgaggcagcctccaggctcaagtggacaacaaacacaggccccacaccccaccaa
actccgtaccagctggacccggccaacatcacgctggaacccatggaaatccgcactttc
ctggcctcagttcaatggaaggaggtggatggttag

  All links  
No link information was found.   
DBGET integrated database retrieval system