KEGG   Homo sapiens (human): 4129Help
Entry
4129              CDS       T01001                                 

Gene name
MAOB
Definition
(RefSeq) monoamine oxidase B (EC:1.4.3.4)
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Drug target
Amezinium metilsulfate: 
Pargyline [DG:DG00264]: 
Isoniazid [DG:DG00642]: 
Selegiline [DG:DG00864]: 
Rasagiline [DG:DG00865]: 
Isocarboxazid: 
Nialamide: 
Phenelzine [DG:DG00948]: 
Tranylcypromine [DG:DG00949]: 
Iproniazide [DG:DG00950]: 
Iproclozide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4129 (MAOB)
   00330 Arginine and proline metabolism
    4129 (MAOB)
   00340 Histidine metabolism
    4129 (MAOB)
   00350 Tyrosine metabolism
    4129 (MAOB)
   00360 Phenylalanine metabolism
    4129 (MAOB)
   00380 Tryptophan metabolism
    4129 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    4129 (MAOB)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    4129 (MAOB)
   04726 Serotonergic synapse
    4129 (MAOB)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    4129 (MAOB)
   05031 Amphetamine addiction
    4129 (MAOB)
   05034 Alcoholism
    4129 (MAOB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     4129 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 520 aa AA seqDB search
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctgcatgactctggactgaatgtggttgttctggaagcccgggaccgtgtggga
ggcaggacttacactcttaggaaccaaaaggttaaatatgtggaccttggaggatcctat
gttggaccaacccagaatcgtatcttgagattagccaaggagctaggattggagacctac
aaagtgaatgaggttgagcgtctgatccaccatgtaaagggcaaatcataccccttcagg
gggccattcccacctgtatggaatccaattacctacttagatcataacaacttttggagg
acaatggatgacatggggcgagagattccgagtgatgccccatggaaggctccccttgca
gaagagtgggacaacatgacaatgaaggagctactggacaagctctgctggactgaatct
gcaaagcagcttgccactctctttgtgaacctgtgtgtcactgcagagacccatgaggtc
tctgctctctggttcctgtggtatgtgaagcagtgtggaggcacaacaagaatcatctcg
acaacaaatggaggacaggagaggaaatttgtgggcggatctggtcaagtgagtgagcgg
ataatggacctccttggagaccgagtgaagctggagaggcctgtgatctacattgaccag
acaagagaaaatgtccttgtggagaccctaaaccatgagatgtatgaggctaaatatgtg
attagtgctattcctcctactctgggcatgaagattcacttcaatccccctctgccaatg
atgagaaaccagatgatcactcgtgtgcctttgggttcagtcatcaagtgtatagtttat
tataaagagcctttctggaggaaaaaggattactgtggaaccatgattattgatggagaa
gaagctccagttgcctacacgttggatgataccaaacctgaaggcaactatgctgccata
atgggatttatcctggcccacaaagccagaaaactggcacgtcttaccaaagaggaaagg
ttgaagaaactttgtgaactctatgccaaggttctgggttccctagaagctctggagcca
gtgcattatgaagaaaagaactggtgtgaggagcagtactctgggggctgctacacaact
tatttcccccctgggatcctgactcaatatggaagggttctacgccagccagtggacagg
atttactttgcaggcaccgagactgccacacactggagcggctacatggagggggctgta
gaggccggggagagagcagcccgagagatcctgcatgccatggggaagattccagaggat
gaaatctggcagtcagaaccagagtctgtggatgtccctgcacagcccatcaccaccacc
tttttggagagacatttgccctccgtgccaggcctgctcaggctgattggattgaccacc
atcttttcagcaacggctcttggcttcctggcccacaaaagggggctacttgtgagagtc
taa

DBGET integrated database retrieval system