KEGG   Homo sapiens (human): 4149Help
Entry
4149              CDS       T01001                                 

Gene name
MAX, bHLHd4
Definition
(RefSeq) MYC associated factor X
  KO
K04453  
Max protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
Disease
H01510  
Malignant paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4149 (MAX)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4149 (MAX)
   05202 Transcriptional misregulation in cancers
    4149 (MAX)
   05222 Small cell lung cancer
    4149 (MAX)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    4149 (MAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P61244(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 160 aa AA seqDB search
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagccacagaatatatccagtatatgcgaaggaaaaaccacaca
caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt
gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc
agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc
taa

DBGET integrated database retrieval system