KEGG   Homo sapiens (human): 4217Help
Entry
4217              CDS       T01001                                 

Gene name
MAP3K5, ASK1, MAPKKK5, MEKK5
Definition
mitogen-activated protein kinase kinase kinase 5 (EC:2.7.11.25)
Orthology
K04426  
mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
TNF signaling pathway
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Amyotrophic lateral sclerosis (ALS)
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22.33
AA seq 1374 aa AA seqDB search
MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaggcggacgagggcatcactttctctgtgccacccttcgccccctcgggc
ttctgcaccatccccgagggcggcatctgcaggaggggaggagcggcggcggtgggcgag
ggcgaggagcaccagctgccaccgccgccgccgggcagcttctggaacgtggagagcgcc
gctgcccctggcatcggttgtccggcggccacctcctcgagcagtgccacccgaggccgg
ggcagctctgttggcgggggcagccgacggaccacggtggcatatgtgatcaacgaagcg
agccaagggcaactggtggtggccgagagcgaggccctgcagagcttgcgggaggcgtgc
gagacagtgggcgccaccctggaaaccctgcattttgggaaactcgactttggagaaacc
accgtgctggaccgcttttacaatgcagatattgcggtggtggagatgagcgatgccttc
cggcagccgtccttgttttaccaccttggggtgagagaaagtttcagcatggccaacaac
atcatcctctactgtgatactaactcggactctctgcagtcactgaaggaaataatttgc
cagaagaatactatgtgcactgggaactacacctttgttccttacatgataactccacat
aacaaagtctactgctgtgacagcagcttcatgaaggggttgacagagctcatgcaaccg
aacttcgagctgcttcttggacccatctgcttacctcttgtggatcgttttattcaactt
ttgaaggtggcacaagcaagttctagccagtacttccgggaatctatactcaatgacatc
aggaaagctcgtaatttatacactggtaaagaattggcagctgagttggcaagaattcgg
cagcgagtagataatatcgaagtcttgacagcagatattgtcataaatctgttactttcc
tacagagatatccaggactatgattctattgtgaagctggtagagactttagaaaaactg
ccaacctttgatttggcctcccatcaccatgtgaagtttcattatgcatttgcactgaat
aggagaaatctccctggtgacagagcaaaagctcttgatattatgattcccatggtgcaa
agcgaaggacaagttgcttcagatatgtattgcctagttggtcgaatctacaaagatatg
tttttggactctaatttcacggacactgaaagcagagaccatggagcttcttggttcaaa
aaggcatttgaatctgagccaacactacagtcaggaattaattatgcggtcctcctcctg
gcagctggacaccagtttgaatcttcctttgagctccggaaagttggggtgaagctaagt
agtcttcttggtaaaaagggaaacttggaaaaactccagagctactgggaagttggattt
tttctgggggccagcgtcctagccaatgaccacatgagagtcattcaagcatctgaaaag
ctttttaaactgaagacaccagcatggtacctcaagtctattgtagagacaattttaata
tataagcattttgtgaaactgaccacagaacagcctgtggccaagcaagaacttgtggac
ttttggatggatttcctggtcgaggccacaaagacagatgttactgtggttaggtttcca
gtattaatattagaaccaaccaaaatctatcaaccttcttatttgtctatcaacaatgaa
gttgaggaaaagacaatctctatttggcacgtgcttcctgatgacaagaaaggtatacat
gagtggaattttagtgcctcttctgtcaggggagtgagtatttctaaatttgaagaaaga
tgctgctttctttatgtgcttcacaattctgatgatttccaaatctatttctgtacagaa
cttcattgtaaaaagttttttgagatggtgaacaccattaccgaagagaaggggagaagc
acagaggaaggagactgtgaaagtgacttgctggagtatgactatgaatatgatgaaaat
ggtgacagagtcgttttaggaaaaggcacttatgggatagtctacgcaggtcgggacttg
agcaaccaagtcagaattgctattaaggaaatcccagagagagacagcagatactctcag
cccctgcatgaagaaatagcattgcataaacacctgaagcacaaaaatattgtccagtat
ctgggctctttcagtgagaatggtttcattaaaatcttcatggagcaggtccctggagga
agtctttctgctctccttcgttccaaatggggtccattaaaagacaatgagcaaacaatt
ggcttttatacaaagcaaatactggaaggattaaaatatctccatgacaatcagatagtt
caccgggacataaagggtgacaatgtgttgattaatacctacagtggtgttctcaagatc
tctgacttcggaacatcaaagaggcttgctggcataaacccctgtactgaaacttttact
ggtaccctccagtatatggcaccagaaataatagataaaggaccaagaggctacggaaaa
gcagcagacatctggtctctgggctgtacaatcattgaaatggccacaggaaaaccccca
ttttatgaactgggagaaccacaagcagctatgttcaaggtgggaatgtttaaagtccac
cctgagatcccagagtccatgtctgcagaggccaaggcattcatactgaaatgttttgaa
ccagatcctgacaagagagcctgtgctaacgacttgcttgttgatgagtttttaaaagtt
tcaagcaaaaagaaaaagacacaacctaagctttcagctctttcagctggatcaaatgaa
tatctcaggagtatatccttgccggtacctgtgctggtggaggacaccagcagcagcagt
gagtacggctcagtttcacccgacacggagttgaaagtggaccccttctctttcaaaaca
agagccaagtcctgcggagaaagagatgtcaagggaattcggacactctttttgggcatt
ccagatgagaattttgaagatcacagtgctcctccttcccctgaagaaaaagattctgga
ttcttcatgctgaggaaggacagtgagaggcgagctacccttcacaggatcctgacggaa
gaccaagacaaaattgtgagaaacctaatggaatctttagctcagggggctgaagaaccg
aaactaaaatgggaacacatcacaaccctcattgcaagcctcagagaatttgtgagatcc
actgaccgaaaaatcatagccaccacactgtcaaagctgaaactggagctggacttcgac
agccatggcattagccaagtccaggtggtactctttggttttcaagatgctgtcaataaa
gttcttcggaatcataacatcaagccgcactggatgtttgccttagacagtatcattcgg
aaggcggtacagacagccattaccatcctggttccagaactaaggccacatttcagcctt
gcatctgagagtgatactgctgatcaagaagacttggatgtagaagatgaccatgaggaa
cagccttcaaatcaaactgtccgaagacctcaggctgtcattgaagatgctgtggctacc
tcaggcgtgagcacgctcagttctactgtgtctcatgattcccagagtgctcaccggtca
ctgaatgtacagcttggaaggatgaaaatagaaaccaatagattactggaagaattggtt
cggaaagagaaagaattacaagcactccttcatcgagctattgaagaaaaagaccaagaa
attaaacacctgaagcttaagtcccaacccatagaaattcctgaattgcctgtatttcat
ctaaattcttctggcacaaatactgaagattctgaacttaccgactggctgagagtgaat
ggagctgatgaagacactataagccggtttttggctgaagattatacactattggatgtt
ctctactatgttacacgtgatgacttaaaatgcttgagactaaggggagggatgctgtgc
acactgtggaaggctatcattgactttcgaaacaaacagacttga

DBGET integrated database retrieval system