KEGG   Homo sapiens (human): 4217Help
Entry
4217              CDS       T01001                                 

Gene name
MAP3K5, ASK1, MAPKKK5, MEKK5
Definition
mitogen-activated protein kinase kinase kinase 5 (EC:2.7.11.25)
Orthology
K04426  
mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
TNF signaling pathway
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Amyotrophic lateral sclerosis (ALS)
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4217 (MAP3K5)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4217 (MAP3K5)
   04668 TNF signaling pathway
    4217 (MAP3K5)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4217 (MAP3K5)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    4217 (MAP3K5)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4217 (MAP3K5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4217 (MAP3K5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   4217 (MAP3K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22.33
AA seq 1374 aa AA seqDB search
MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaggcggacgagggcatcactttctctgtgccacccttcgccccctcgggc
ttctgcaccatccccgagggcggcatctgcaggaggggaggagcggcggcggtgggcgag
ggcgaggagcaccagctgccaccgccgccgccgggcagcttctggaacgtggagagcgcc
gctgcccctggcatcggttgtccggcggccacctcctcgagcagtgccacccgaggccgg
ggcagctctgttggcgggggcagccgacggaccacggtggcatatgtgatcaacgaagcg
agccaagggcaactggtggtggccgagagcgaggccctgcagagcttgcgggaggcgtgc
gagacagtgggcgccaccctggaaaccctgcattttgggaaactcgactttggagaaacc
accgtgctggaccgcttttacaatgcagatattgcggtggtggagatgagcgatgccttc
cggcagccgtccttgttttaccaccttggggtgagagaaagtttcagcatggccaacaac
atcatcctctactgtgatactaactcggactctctgcagtcactgaaggaaataatttgc
cagaagaatactatgtgcactgggaactacacctttgttccttacatgataactccacat
aacaaagtctactgctgtgacagcagcttcatgaaggggttgacagagctcatgcaaccg
aacttcgagctgcttcttggacccatctgcttacctcttgtggatcgttttattcaactt
ttgaaggtggcacaagcaagttctagccagtacttccgggaatctatactcaatgacatc
aggaaagctcgtaatttatacactggtaaagaattggcagctgagttggcaagaattcgg
cagcgagtagataatatcgaagtcttgacagcagatattgtcataaatctgttactttcc
tacagagatatccaggactatgattctattgtgaagctggtagagactttagaaaaactg
ccaacctttgatttggcctcccatcaccatgtgaagtttcattatgcatttgcactgaat
aggagaaatctccctggtgacagagcaaaagctcttgatattatgattcccatggtgcaa
agcgaaggacaagttgcttcagatatgtattgcctagttggtcgaatctacaaagatatg
tttttggactctaatttcacggacactgaaagcagagaccatggagcttcttggttcaaa
aaggcatttgaatctgagccaacactacagtcaggaattaattatgcggtcctcctcctg
gcagctggacaccagtttgaatcttcctttgagctccggaaagttggggtgaagctaagt
agtcttcttggtaaaaagggaaacttggaaaaactccagagctactgggaagttggattt
tttctgggggccagcgtcctagccaatgaccacatgagagtcattcaagcatctgaaaag
ctttttaaactgaagacaccagcatggtacctcaagtctattgtagagacaattttaata
tataagcattttgtgaaactgaccacagaacagcctgtggccaagcaagaacttgtggac
ttttggatggatttcctggtcgaggccacaaagacagatgttactgtggttaggtttcca
gtattaatattagaaccaaccaaaatctatcaaccttcttatttgtctatcaacaatgaa
gttgaggaaaagacaatctctatttggcacgtgcttcctgatgacaagaaaggtatacat
gagtggaattttagtgcctcttctgtcaggggagtgagtatttctaaatttgaagaaaga
tgctgctttctttatgtgcttcacaattctgatgatttccaaatctatttctgtacagaa
cttcattgtaaaaagttttttgagatggtgaacaccattaccgaagagaaggggagaagc
acagaggaaggagactgtgaaagtgacttgctggagtatgactatgaatatgatgaaaat
ggtgacagagtcgttttaggaaaaggcacttatgggatagtctacgcaggtcgggacttg
agcaaccaagtcagaattgctattaaggaaatcccagagagagacagcagatactctcag
cccctgcatgaagaaatagcattgcataaacacctgaagcacaaaaatattgtccagtat
ctgggctctttcagtgagaatggtttcattaaaatcttcatggagcaggtccctggagga
agtctttctgctctccttcgttccaaatggggtccattaaaagacaatgagcaaacaatt
ggcttttatacaaagcaaatactggaaggattaaaatatctccatgacaatcagatagtt
caccgggacataaagggtgacaatgtgttgattaatacctacagtggtgttctcaagatc
tctgacttcggaacatcaaagaggcttgctggcataaacccctgtactgaaacttttact
ggtaccctccagtatatggcaccagaaataatagataaaggaccaagaggctacggaaaa
gcagcagacatctggtctctgggctgtacaatcattgaaatggccacaggaaaaccccca
ttttatgaactgggagaaccacaagcagctatgttcaaggtgggaatgtttaaagtccac
cctgagatcccagagtccatgtctgcagaggccaaggcattcatactgaaatgttttgaa
ccagatcctgacaagagagcctgtgctaacgacttgcttgttgatgagtttttaaaagtt
tcaagcaaaaagaaaaagacacaacctaagctttcagctctttcagctggatcaaatgaa
tatctcaggagtatatccttgccggtacctgtgctggtggaggacaccagcagcagcagt
gagtacggctcagtttcacccgacacggagttgaaagtggaccccttctctttcaaaaca
agagccaagtcctgcggagaaagagatgtcaagggaattcggacactctttttgggcatt
ccagatgagaattttgaagatcacagtgctcctccttcccctgaagaaaaagattctgga
ttcttcatgctgaggaaggacagtgagaggcgagctacccttcacaggatcctgacggaa
gaccaagacaaaattgtgagaaacctaatggaatctttagctcagggggctgaagaaccg
aaactaaaatgggaacacatcacaaccctcattgcaagcctcagagaatttgtgagatcc
actgaccgaaaaatcatagccaccacactgtcaaagctgaaactggagctggacttcgac
agccatggcattagccaagtccaggtggtactctttggttttcaagatgctgtcaataaa
gttcttcggaatcataacatcaagccgcactggatgtttgccttagacagtatcattcgg
aaggcggtacagacagccattaccatcctggttccagaactaaggccacatttcagcctt
gcatctgagagtgatactgctgatcaagaagacttggatgtagaagatgaccatgaggaa
cagccttcaaatcaaactgtccgaagacctcaggctgtcattgaagatgctgtggctacc
tcaggcgtgagcacgctcagttctactgtgtctcatgattcccagagtgctcaccggtca
ctgaatgtacagcttggaaggatgaaaatagaaaccaatagattactggaagaattggtt
cggaaagagaaagaattacaagcactccttcatcgagctattgaagaaaaagaccaagaa
attaaacacctgaagcttaagtcccaacccatagaaattcctgaattgcctgtatttcat
ctaaattcttctggcacaaatactgaagattctgaacttaccgactggctgagagtgaat
ggagctgatgaagacactataagccggtttttggctgaagattatacactattggatgtt
ctctactatgttacacgtgatgacttaaaatgcttgagactaaggggagggatgctgtgc
acactgtggaaggctatcattgactttcgaaacaaacagacttga

DBGET integrated database retrieval system