KEGG   Homo sapiens (human): 4218Help
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  
Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
AMPK signaling pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4218 (RAB8A)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4218 (RAB8A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 207 aa AA seqDB search
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system