KEGG   Homo sapiens (human): 4218Help
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
RAB8A, member RAS oncogene family
Orthology
K07901  
Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 207 aa AA seqDB search
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system