KEGG   Homo sapiens (human): 4247Help
Entry
4247              CDS       T01001                                 

Gene name
MGAT2, CDG2A, CDGS2, GLCNACTII, GNT-II, GNT2
Definition
mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC:2.4.1.143)
Orthology
K00736  
alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Disease
H00119  
Congenital disorders of glycosylation (CDG) type II
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q21
AA seq 447 aa AA seqDB search
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaggttccgcatctacaaacggaaggtgctaatcctgacgctcgtggtggccgcctgc
ggcttcgtcctctggagcagcaatgggcgacaaaggaagaacgaggccctcgccccaccg
ttgctggacgccgaacccgcgcggggtgccggcggccgcggtggggaccacccctctgtg
gctgtgggcatccgcagggtctccaacgtgtcggcggcttccctggtcccggcggtcccc
cagcccgaggcggacaacctgacgctgcggtaccggtccctggtgtaccagctgaacttt
gatcagaccctgaggaatgtagataaggctggcacctgggccccccgggagctggtgctg
gtggtccaggtgcataaccggcccgaatacctcagactgctgctggactcacttcgaaaa
gcccagggaattgacaacgtcctcgtcatctttagccatgacttctggtcgaccgagatc
aatcagctgatcgccggggtgaatttctgtccggttctgcaggtgttctttcctttcagc
attcagttgtaccctaacgagtttccaggtagtgaccctagagattgtcccagagacctg
ccgaagaatgccgctttgaaattggggtgcatcaatgctgagtatcccgactccttcggc
cattatagagaggccaaattctcccagaccaaacatcactggtggtggaagctgcatttt
gtgtgggaaagagtgaaaattcttcgagattatgctggccttatacttttcctagaagag
gatcactacttagccccagacttttaccatgtcttcaaaaagatgtggaaactgaagcag
caagagtgccctgaatgtgatgttctctccctggggacctatagtgccagtcgcagtttc
tatggcatggctgacaaggtagatgtgaaaacttggaaatccacagagcacaatatgggt
ctagccttgacccggaatgcctatcagaagctgatcgagtgcacagacactttctgtact
tatgatgattataactgggactggactcttcaatacttgactgtatcttgtcttccaaaa
ttctggaaagtgctggttcctcaaattcctaggatctttcatgctggagactgtggtatg
catcacaagaaaacctgtagaccatccactcagagtgcccaaattgagtcactcttaaat
aataacaaacaatacatgtttccagaaactctaactatcagtgaaaagtttactgtggta
gccatttccccacctagaaaaaatggagggtggggagatattagggaccatgaactctgt
aaaagttatagaagactgcagtga

DBGET integrated database retrieval system