KEGG   Homo sapiens (human): 4261Help
Entry
4261              CDS       T01001                                 

Gene name
CIITA, C2TA, CIITAIV, MHC2TA, NLRA
Definition
class II, major histocompatibility complex, transactivator
Orthology
K08060  
class II, major histocompatibility complex, transactivator
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Toxoplasmosis
Tuberculosis
Influenza A
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00985  
Bare lymphocyte syndrome (BLS) type2
Class
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13
AA seq 1130 aa AA seqDB search
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVGPVSDCS
TLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGL
WQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGIL
VEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRG
CTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGAL
WLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCLGALLGPSAAA
SVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKL
EFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETL
NLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQ
YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcctggctccacgccctgctgggtcctacctgtcagagccccaaggcagctca
cagtgtgccaccatggagttggggcccctagaaggtggctacctggagcttcttaacagc
gatgctgaccccctgtgcctctaccacttctatgaccagatggacctggctggagaagaa
gagattgagctctactcagaacccgacacagacaccatcaactgcgaccagttcagcagg
ctgttgtgtgacatggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaa
ctggaccagtatgtcttccaggactcccagctggagggcctgagcaaggacattttcaag
cacataggaccagatgaagtgatcggtgagagtatggagatgccagcagaagttgggcag
aaaagtcagaaaagacccttcccagaggagcttccggcagacctgaagcactggaagcca
gctgagccccccactgtggtgactggcagtctcctagtgggaccagtgagcgactgctcc
accctgccctgcctgccactgcctgcgctgttcaaccaggagccagcctccggccagatg
cgcctggagaaaaccgaccagattcccatgcctttctccagttcctcgttgagctgcctg
aatctccctgagggacccatccagtttgtccccaccatctccactctgccccatgggctc
tggcaaatctctgaggctggaacaggggtctccagtatattcatctaccatggtgaggtg
ccccaggccagccaagtaccccctcccagtggattcactgtccacggcctcccaacatct
ccagaccggccaggctccaccagccccttcgctccatcagccactgacctgcccagcatg
cctgaacctgccctgacctcccgagcaaacatgacagagcacaagacgtcccccacccaa
tgcccggcagctggagaggtctccaacaagcttccaaaatggcctgagccggtggagcag
ttctaccgctcactgcaggacacgtatggtgccgagcccgcaggcccggatggcatccta
gtggaggtggatctggtgcaggccaggctggagaggagcagcagcaagagcctggagcgg
gaactggccaccccggactgggcagaacggcagctggcccaaggaggcctggctgaggtg
ctgttggctgccaaggagcaccggcggccgcgtgagacacgagtgattgctgtgctgggc
aaagctggtcagggcaagagctattgggctggggcagtgagccgggcctgggcttgtggc
cggcttccccagtacgactttgtcttctctgtcccctgccattgcttgaaccgtccgggg
gatgcctatggcctgcaggatctgctcttctccctgggcccacagccactcgtggcggcc
gatgaggttttcagccacatcttgaagagacctgaccgcgttctgctcatcctagacggc
ttcgaggagctggaagcgcaagatggcttcctgcacagcacgtgcggaccggcaccggcg
gagccctgctccctccgggggctgctggccggccttttccagaagaagctgctccgaggt
tgcaccctcctcctcacagcccggccccggggccgcctggtccagagcctgagcaaggcc
gacgccctatttgagctgtccggcttctccatggagcaggcccaggcatacgtgatgcgc
tactttgagagctcagggatgacagagcaccaagacagagccctgacgctcctccgggac
cggccacttcttctcagtcacagccacagccctactttgtgccgggcagtgtgccagctc
tcagaggccctgctggagcttggggaggacgccaagctgccctccacgctcacgggactc
tatgtcggcctgctgggccgtgcagccctcgacagcccccccggggccctggcagagctg
gccaagctggcctgggagctgggccgcagacatcaaagtaccctacaggaggaccagttc
ccatccgcagacgtgaggacctgggcgatggccaaaggcttagtccaacacccaccgcgg
gccgcagagtccgagctggccttccccagcttcctcctgcaatgcttcctgggggccctg
tggctggctctgagtggcgaaatcaaggacaaggagctcccgcagtacctagcattgacc
ccaaggaagaagaggccctatgacaactggctggagggcgtgccacgctttctggctggg
ctgatcttccagcctcccgcccgctgcctgggagccctactcgggccatcggcggctgcc
tcggtggacaggaagcagaaggtgcttgcgaggtacctgaagcggctgcagccggggaca
ctgcgggcgcggcagctgctggagctgctgcactgcgcccacgaggccgaggaggctgga
atttggcagcacgtggtacaggagctccccggccgcctctcttttctgggcacccgcctc
acgcctcctgatgcacatgtactgggcaaggccttggaggcggcgggccaagacttctcc
ctggacctccgcagcactggcatttgcccctctggattggggagcctcgtgggactcagc
tgtgtcacccgtttcagggctgccttgagcgacacggtggcgctgtgggagtccctgcag
cagcatggggagaccaagctacttcaggcagcagaggagaagttcaccatcgagcctttc
aaagccaagtccctgaaggatgtggaagacctgggaaagcttgtgcagactcagaggacg
agaagttcctcggaagacacagctggggagctccctgctgttcgggacctaaagaaactg
gagtttgcgctgggccctgtctcaggcccccaggctttccccaaactggtgcggatcctc
acggccttttcctccctgcagcatctggacctggatgcgctgagtgagaacaagatcggg
gacgagggtgtctcgcagctctcagccaccttcccccagctgaagtccttggaaaccctc
aatctgtcccagaacaacatcactgacctgggtgcctacaaactcgccgaggccctgcct
tcgctcgctgcatccctgctcaggctaagcttgtacaataactgcatctgcgacgtggga
gccgagagcttggctcgtgtgcttccggacatggtgtccctccgggtgatggacgtccag
tacaacaagttcacggctgccggggcccagcagctcgctgccagccttcggaggtgtcct
catgtggagacgctggcgatgtggacgcccaccatcccattcagtgtccaggaacacctg
caacaacaggattcacggatcagcctgagatga

DBGET integrated database retrieval system