KEGG   Homo sapiens (human): 4261Help
Entry
4261              CDS       T01001                                 

Gene name
CIITA, C2TA, CIITAIV, MHC2TA, NLRA
Definition
class II, major histocompatibility complex, transactivator (EC:2.7.11.1)
Orthology
K08060  
class II, major histocompatibility complex, transactivator
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Toxoplasmosis
Tuberculosis
Influenza A
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00985  
Bare lymphocyte syndrome (BLS) type2
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    4261 (CIITA)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    4261 (CIITA)
  Infectious diseases
   05152 Tuberculosis
    4261 (CIITA)
   05164 Influenza A
    4261 (CIITA)
   05145 Toxoplasmosis
    4261 (CIITA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13
AA seq 1130 aa AA seqDB search
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVGPVSDCS
TLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGL
WQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGIL
VEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRG
CTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGAL
WLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCLGALLGPSAAA
SVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKL
EFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETL
NLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQ
YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcctggctccacgccctgctgggtcctacctgtcagagccccaaggcagctca
cagtgtgccaccatggagttggggcccctagaaggtggctacctggagcttcttaacagc
gatgctgaccccctgtgcctctaccacttctatgaccagatggacctggctggagaagaa
gagattgagctctactcagaacccgacacagacaccatcaactgcgaccagttcagcagg
ctgttgtgtgacatggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaa
ctggaccagtatgtcttccaggactcccagctggagggcctgagcaaggacattttcaag
cacataggaccagatgaagtgatcggtgagagtatggagatgccagcagaagttgggcag
aaaagtcagaaaagacccttcccagaggagcttccggcagacctgaagcactggaagcca
gctgagccccccactgtggtgactggcagtctcctagtgggaccagtgagcgactgctcc
accctgccctgcctgccactgcctgcgctgttcaaccaggagccagcctccggccagatg
cgcctggagaaaaccgaccagattcccatgcctttctccagttcctcgttgagctgcctg
aatctccctgagggacccatccagtttgtccccaccatctccactctgccccatgggctc
tggcaaatctctgaggctggaacaggggtctccagtatattcatctaccatggtgaggtg
ccccaggccagccaagtaccccctcccagtggattcactgtccacggcctcccaacatct
ccagaccggccaggctccaccagccccttcgctccatcagccactgacctgcccagcatg
cctgaacctgccctgacctcccgagcaaacatgacagagcacaagacgtcccccacccaa
tgcccggcagctggagaggtctccaacaagcttccaaaatggcctgagccggtggagcag
ttctaccgctcactgcaggacacgtatggtgccgagcccgcaggcccggatggcatccta
gtggaggtggatctggtgcaggccaggctggagaggagcagcagcaagagcctggagcgg
gaactggccaccccggactgggcagaacggcagctggcccaaggaggcctggctgaggtg
ctgttggctgccaaggagcaccggcggccgcgtgagacacgagtgattgctgtgctgggc
aaagctggtcagggcaagagctattgggctggggcagtgagccgggcctgggcttgtggc
cggcttccccagtacgactttgtcttctctgtcccctgccattgcttgaaccgtccgggg
gatgcctatggcctgcaggatctgctcttctccctgggcccacagccactcgtggcggcc
gatgaggttttcagccacatcttgaagagacctgaccgcgttctgctcatcctagacggc
ttcgaggagctggaagcgcaagatggcttcctgcacagcacgtgcggaccggcaccggcg
gagccctgctccctccgggggctgctggccggccttttccagaagaagctgctccgaggt
tgcaccctcctcctcacagcccggccccggggccgcctggtccagagcctgagcaaggcc
gacgccctatttgagctgtccggcttctccatggagcaggcccaggcatacgtgatgcgc
tactttgagagctcagggatgacagagcaccaagacagagccctgacgctcctccgggac
cggccacttcttctcagtcacagccacagccctactttgtgccgggcagtgtgccagctc
tcagaggccctgctggagcttggggaggacgccaagctgccctccacgctcacgggactc
tatgtcggcctgctgggccgtgcagccctcgacagcccccccggggccctggcagagctg
gccaagctggcctgggagctgggccgcagacatcaaagtaccctacaggaggaccagttc
ccatccgcagacgtgaggacctgggcgatggccaaaggcttagtccaacacccaccgcgg
gccgcagagtccgagctggccttccccagcttcctcctgcaatgcttcctgggggccctg
tggctggctctgagtggcgaaatcaaggacaaggagctcccgcagtacctagcattgacc
ccaaggaagaagaggccctatgacaactggctggagggcgtgccacgctttctggctggg
ctgatcttccagcctcccgcccgctgcctgggagccctactcgggccatcggcggctgcc
tcggtggacaggaagcagaaggtgcttgcgaggtacctgaagcggctgcagccggggaca
ctgcgggcgcggcagctgctggagctgctgcactgcgcccacgaggccgaggaggctgga
atttggcagcacgtggtacaggagctccccggccgcctctcttttctgggcacccgcctc
acgcctcctgatgcacatgtactgggcaaggccttggaggcggcgggccaagacttctcc
ctggacctccgcagcactggcatttgcccctctggattggggagcctcgtgggactcagc
tgtgtcacccgtttcagggctgccttgagcgacacggtggcgctgtgggagtccctgcag
cagcatggggagaccaagctacttcaggcagcagaggagaagttcaccatcgagcctttc
aaagccaagtccctgaaggatgtggaagacctgggaaagcttgtgcagactcagaggacg
agaagttcctcggaagacacagctggggagctccctgctgttcgggacctaaagaaactg
gagtttgcgctgggccctgtctcaggcccccaggctttccccaaactggtgcggatcctc
acggccttttcctccctgcagcatctggacctggatgcgctgagtgagaacaagatcggg
gacgagggtgtctcgcagctctcagccaccttcccccagctgaagtccttggaaaccctc
aatctgtcccagaacaacatcactgacctgggtgcctacaaactcgccgaggccctgcct
tcgctcgctgcatccctgctcaggctaagcttgtacaataactgcatctgcgacgtggga
gccgagagcttggctcgtgtgcttccggacatggtgtccctccgggtgatggacgtccag
tacaacaagttcacggctgccggggcccagcagctcgctgccagccttcggaggtgtcct
catgtggagacgctggcgatgtggacgcccaccatcccattcagtgtccaggaacacctg
caacaacaggattcacggatcagcctgagatga

DBGET integrated database retrieval system