KEGG   Homo sapiens (human): 4283Help
Entry
4283              CDS       T01001                                 

Gene name
CXCL9, CMK, Humig, MIG, SCYB9, crg-10
Definition
(RefSeq) C-X-C motif chemokine ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4283 (CXCL9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    4283 (CXCL9)
   04062 Chemokine signaling pathway
    4283 (CXCL9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   4283 (CXCL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 VasL MRP-S27 ParB Tmemb_161AB
Motif
Other DBs
NCBI-GeneID: 4283
NCBI-ProteinID: NP_002407
OMIM: 601704
HGNC: 7098
Ensembl: ENSG00000138755
Vega: OTTHUMG00000160889
Pharos: Q07325(Tbio)
UniProt: Q07325
Position
4q21.1
AA seq 125 aa AA seqDB search
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtggtgttcttttcctcttgggcatcatcttgctggttctgattggagtg
caaggaaccccagtagtgagaaagggtcgctgttcctgcatcagcaccaaccaagggact
atccacctacaatccttgaaagaccttaaacaatttgccccaagcccttcctgcgagaaa
attgaaatcattgctacactgaagaatggagttcaaacatgtctaaacccagattcagca
gatgtgaaggaactgattaaaaagtgggagaaacaggtcagccaaaagaaaaagcaaaag
aatgggaaaaaacatcaaaaaaagaaagttctgaaagttcgaaaatctcaacgttctcgt
caaaagaagactacataa

DBGET integrated database retrieval system