KEGG   Homo sapiens (human): 4283Help
Entry
4283              CDS       T01001                                 

Gene name
CXCL9, CMK, Humig, MIG, SCYB9, crg-10
Definition
chemokine (C-X-C motif) ligand 9
Orthology
K05416  
C-X-C motif chemokine 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
Disease
H01360  
Allergic rhinitis
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 125 aa AA seqDB search
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtggtgttcttttcctcttgggcatcatcttgctggttctgattggagtg
caaggaaccccagtagtgagaaagggtcgctgttcctgcatcagcaccaaccaagggact
atccacctacaatccttgaaagaccttaaacaatttgccccaagcccttcctgcgagaaa
attgaaatcattgctacactgaagaatggagttcaaacatgtctaaacccagattcagca
gatgtgaaggaactgattaaaaagtgggagaaacaggtcagccaaaagaaaaagcaaaag
aatgggaaaaaacatcaaaaaaagaaagttctgaaagttcgaaaatctcaacgttctcgt
caaaagaagactacataa

DBGET integrated database retrieval system