KEGG   Homo sapiens (human): 4283Help
Entry
4283              CDS       T01001                                 

Gene name
CXCL9, CMK, Humig, MIG, SCYB9, crg-10
Definition
chemokine (C-X-C motif) ligand 9
Orthology
K05416  
C-X-C motif chemokine 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Toll-like receptor signaling pathway
Disease
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4283 (CXCL9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    4283 (CXCL9)
   04062 Chemokine signaling pathway
    4283 (CXCL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21
AA seq 125 aa AA seqDB search
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtggtgttcttttcctcttgggcatcatcttgctggttctgattggagtg
caaggaaccccagtagtgagaaagggtcgctgttcctgcatcagcaccaaccaagggact
atccacctacaatccttgaaagaccttaaacaatttgccccaagcccttcctgcgagaaa
attgaaatcattgctacactgaagaatggagttcaaacatgtctaaacccagattcagca
gatgtgaaggaactgattaaaaagtgggagaaacaggtcagccaaaagaaaaagcaaaag
aatgggaaaaaacatcaaaaaaagaaagttctgaaagttcgaaaatctcaacgttctcgt
caaaagaagactacataa

DBGET integrated database retrieval system