KEGG   Homo sapiens (human): 4296Help
Entry
4296              CDS       T01001                                 

Gene name
MAP3K11, MEKK11, MLK-3, MLK3, PTK1, SPRK
Definition
mitogen-activated protein kinase kinase kinase 11 (EC:2.7.11.25)
Orthology
K04419  
mitogen-activated protein kinase kinase kinase 11 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4296 (MAP3K11)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4296 (MAP3K11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4296 (MAP3K11)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   4296 (MAP3K11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1-q13.3
AA seq 847 aa AA seqDB search
MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPL
GSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRD
LQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPV
GQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWS
FVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAP
WVPEAGP
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttgaagagcctcttcctcaagagccctctagggtcatggaatggcagtggc
agcgggggtggtgggggcggtggaggaggccggcctgaggggtctccaaaggcagcgggt
tatgccaacccggtgtggacagccctgttcgactacgagcccagtgggcaggatgagctg
gccctgaggaagggtgaccgtgtggaggtgctgtcccgggacgcagccatctcaggagac
gagggctggtgggcgggccaggtgggtggccaggtgggcatcttcccgtccaactatgtg
tctcggggtggcggcccgcccccctgcgaggtggccagcttccaggagctgcggctggag
gaggtgatcggcattggaggctttggcaaggtgtacaggggcagctggcgaggtgagctg
gtggctgtgaaggcagctcgccaggaccccgatgaggacatcagtgtgacagccgagagc
gttcgccaggaggcccggctcttcgccatgctggcacaccccaacatcattgccctcaag
gctgtgtgcctggaggagcccaacctgtgcctggtgatggagtatgcagccggtgggccc
ctcagccgagctctggccgggcggcgcgtgcctccccatgtgctggtcaactgggctgtg
cagattgcccgtgggatgcactacctgcactgcgaggccctggtgcccgtcatccaccgt
gatctcaagtccaacaacattttgctgctgcagcccattgagagtgacgacatggagcac
aagaccctgaagatcaccgactttggcctggcccgagagtggcacaaaaccacacaaatg
agtgccgcgggcacctacgcctggatggctcctgaggttatcaaggcctccaccttctct
aagggcagtgacgtctggagttttggggtgctgctgtgggaactgctgaccggggaggtg
ccataccgtggcattgactgccttgctgtggcctatggcgtagctgttaacaagctcaca
ctgcccatcccatccacctgccccgagcccttcgcacagcttatggccgactgctgggcg
caggacccccaccgcaggcccgacttcgcctccatcctgcagcagttggaggcgctggag
gcacaggtcctacgggaaatgccgcgggactccttccattccatgcaggaaggctggaag
cgcgagatccagggtctcttcgacgagctgcgagccaaggaaaaggaactactgagccgc
gaggaggagctgacgcgagcggcgcgcgagcagcggtcacaggcggagcagctgcggcgg
cgcgagcacctgctggcccagtgggagctagaggtgttcgagcgcgagctgacgctgctg
ctgcagcaggtggaccgcgagcgaccgcacgtgcgccgccgccgcgggacattcaagcgc
agcaagctccgggcgcgcgacggcggcgagcgtatcagcatgccactcgacttcaagcac
cgcatcaccgtgcaggcctcacccggccttgaccggaggagaaacgtcttcgaggtcggg
cctggggattcgcccacctttccccggttccgagccatccagttggagcctgcagagcca
ggccaggcatggggccgccagtccccccgacgtctggaggactcaagcaatggagagcgg
cgagcatgctgggcttggggtcccagttcccccaagcctggggaagcccagaatgggagg
agaaggtcccgcatggacgaagccacatggtacctggattcagatgactcatccccctta
ggatctccttccacacccccagcactcaatggtaaccccccgcggcctagcctggagccc
gaggagcccaagaggcctgtccccgcagagcgcggtagcagctctgggacgcccaagctg
atccagcgggcgctgctgcgcggcaccgccctgctcgcctcgctgggccttggccgcgac
ctgcagccgccgggaggcccaggacgcgagcgcggggagtccccgacaacaccccccacg
ccaacgcccgcgccctgcccgaccgagccgcccccttccccgctcatctgcttctcgctc
aagacgcccgactccccgcccactcctgcacccctgttgctggacctgggtatccctgtg
ggccagcggtcagccaagagcccccgacgtgaggaggagccccgcggaggcactgtctca
cccccaccggggacatcacgctctgctcctggcaccccaggcaccccacgttcaccaccc
ctgggcctcatcagccgacctcggccctcgccccttcgcagccgcattgatccctggagc
tttgtgtcagctgggccacggccttctcccctgccatcaccacagcctgcaccccgccga
gcaccctggaccttgttcccggactcagaccccttctgggactccccacctgccaacccc
ttccaggggggcccccaggactgcagggcacagaccaaagacatgggtgcccaggccccg
tgggtgccggaagcggggccttga

DBGET integrated database retrieval system