KEGG   Homo sapiens (human): 43Help
Entry
43                CDS       T01001                                 

Gene name
ACHE, ACEE, ARACHE, N-ACHE, YT
Definition
acetylcholinesterase (Yt blood group) (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Drug target
Dimetacrine: 
Tacrine: 
Donepezil: 
Rivastigmine: 
Galantamine: 
Ipidacrine: 
Neostigmine: 
Pyridostigmine: 
Distigmine: 
Ambenonium: 
Ecothiopate: 
Demecarium: 
Physostigmine: 
Fluostigmine: 
Pralidoxime: 
Obidoxime: 
Other: 
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22
AA seq 614 aa AA seqDB search
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccccgcagtgtctgctgcacacgccttccctggcttccccactccttctcctc
ctcctctggctcctgggtggaggagtgggggctgagggccgggaggatgcagagctgctg
gtgacggtgcgtgggggccggctgcggggcattcgcctgaagacccccgggggccctgtc
tctgctttcctgggcatcccctttgcggagccacccatgggaccccgtcgctttctgcca
ccggagcccaagcagccttggtcaggggtggtagacgctacaaccttccagagtgtctgc
taccaatatgtggacaccctatacccaggttttgagggcaccgagatgtggaaccccaac
cgtgagctgagcgaggactgcctgtacctcaacgtgtggacaccatacccccggcctaca
tcccccacccctgtcctcgtctggatctatgggggtggcttctacagtggggcctcctcc
ttggacgtgtacgatggccgcttcttggtacaggccgagaggactgtgctggtgtccatg
aactaccgggtgggagcctttggcttcctggccctgccggggagccgagaggccccgggc
aatgtgggtctcctggatcagaggctggccctgcagtgggtgcaggagaacgtggcagcc
ttcgggggtgacccgacatcagtgacgctgtttggggagagcgcgggagccgcctcggtg
ggcatgcacctgctgtccccgcccagccggggcctgttccacagggccgtgctgcagagc
ggtgcccccaatggaccctgggccacggtgggcatgggagaggcccgtcgcagggccacg
cagctggcccaccttgtgggctgtcctccaggcggcactggtgggaatgacacagagctg
gtagcctgccttcggacacgaccagcgcaggtcctggtgaaccacgaatggcacgtgctg
cctcaagaaagcgtcttccggttctccttcgtgcctgtggtagatggagacttcctcagt
gacaccccagaggccctcatcaacgcgggagacttccacggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcgtattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgggccgagttcctggccggggtgcgggtcggggttccccag
gtaagtgacctggcagccgaggctgtggtcctgcattacacagactggctgcatcccgag
gacccggcacgcctgagggaggccctgagcgatgtggtgggcgaccacaatgtcgtgtgc
cccgtggcccagctggctgggcgactggctgcccagggtgcccgggtctacgcctacgtc
tttgaacaccgtgcttccacgctctcctggcccctgtggatgggggtgccccacggctac
gagatcgagttcatctttgggatccccctggacccctctcgaaactacacggcagaggag
aaaatcttcgcccagcgactgatgcgatactgggccaactttgcccgcacaggggatccc
aatgagccccgagaccccaaggccccacaatggcccccgtacacggcgggggctcagcag
tacgttagtctggacctgcggccgctggaggtgcggcgggggctgcgcgcccaggcctgc
gccttctggaaccgcttcctccccaaattgctcagcgccaccgacacgctcgacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system