KEGG   Homo sapiens (human): 4311Help
Entry
4311              CDS       T01001                                 

Gene name
MME, CALLA, CD10, NEP, SFE
Definition
membrane metallo-endopeptidase (EC:3.4.24.11)
Orthology
K01389  
neprilysin [EC:3.4.24.11]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Hematopoietic cell lineage
Protein digestion and absorption
Alzheimer's disease
Drug target
Racecadotril: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    4311 (MME)
  Endocrine system
   04614 Renin-angiotensin system
    4311 (MME)
  Digestive system
   04974 Protein digestion and absorption
    4311 (MME)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4311 (MME)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     4311 (MME)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M13: neprilysin family
   4311 (MME)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4311 (MME)
Cellular antigens [BR:hsa04090]
 Proteins
  4311 (MME)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.2
AA seq 750 aa AA seqDB search
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggactccactggagatcagcctctcggtccttgtcctgctcctcaccatc
atagctgtgacaatgatcgcactctatgcaacctacgatgatggtatttgcaagtcatca
gactgcataaaatcagctgctcgactgatccaaaacatggatgccaccactgagccttgt
acagactttttcaaatatgcttgcggaggctggttgaaacgtaatgtcattcccgagacc
agctcccgttacggcaactttgacattttaagagatgaactagaagtcgttttgaaagat
gtccttcaagaacccaaaactgaagatatagtagcagtgcagaaagcaaaagcattgtac
aggtcttgtataaatgaatctgctattgatagcagaggtggagaacctctactcaaactg
ttaccagacatatatgggtggccagtagcaacagaaaactgggagcaaaaatatggtgct
tcttggacagctgaaaaagctattgcacaactgaattctaaatatgggaaaaaagtcctt
attaatttgtttgttggcactgatgataagaattctgtgaatcatgtaattcatattgac
caacctcgacttggcctcccttctagagattactatgaatgcactggaatctataaagag
gcttgtacagcatatgtggattttatgatttctgtggccagattgattcgtcaggaagaa
agattgcccatcgatgaaaaccagcttgctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacggctaaacctgaagatcgaaatgatccaatgcttctgtat
aacaagatgacattggcccagatccaaaataacttttcactagagatcaatgggaagcca
ttcagctggttgaatttcacaaatgaaatcatgtcaactgtgaatattagtattacaaat
gaggaagatgtggttgtttatgctccagaatatttaaccaaacttaagcccattcttacc
aaatattctgccagagatcttcaaaatttaatgtcctggagattcataatggatcttgta
agcagcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctttatggt
acaacctcagaaacagcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgctgtggggaggctttatgtggaagcagcatttgctggagagagtaaacatgtggtc
gaggatttgattgcacagatccgagaagtttttattcagactttagatgacctcacttgg
atggatgccgagacaaaaaagagagctgaagaaaaggccttagcaattaaagaaaggatc
ggctatcctgatgacattgtttcaaatgataacaaactgaataatgagtacctcgagttg
aactacaaagaagatgaatacttcgagaacataattcaaaatttgaaattcagccaaagt
aaacaactgaagaagctccgagaaaaggtggacaaagatgagtggataagtggagcagct
gtagtcaatgcattttactcttcaggaagaaatcagatagtcttcccagccggcattctg
cagccccccttctttagtgcccagcagtccaactcattgaactatgggggcatcggcatg
gtcataggacacgaaatcacccatggcttcgatgacaatggcagaaactttaacaaagat
ggagacctcgttgactggtggactcaacagtctgcaagtaactttaaggagcaatcccag
tgcatggtgtatcagtatggaaacttttcctgggacctggcaggtggacagcaccttaat
ggaattaatacactgggagaaaacattgctgataatggaggtcttggtcaagcatacaga
gcctatcagaattatattaaaaagaatggcgaagaaaaattacttcctggacttgaccta
aatcacaaacaactatttttcttgaactttgcacaggtgtggtgtggaacctataggcca
gagtatgcggttaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctgcagagttttcagaagcctttcactgccgcaagaattcatac
atgaatccagaaaagaagtgccgggtttggtga

DBGET integrated database retrieval system