KEGG   Homo sapiens (human): 4312Help
Entry
4312              CDS       T01001                                 

Gene name
MMP1, CLG, CLGN
Definition
(RefSeq) matrix metallopeptidase 1
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04657  IL-17 signaling pathway
hsa04926  Relaxin signaling pathway
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
Disease
H00028  Choriocarcinoma
Drug target
Cipemastat: D03517
Marimastat: D03795
Rebimastat: D03800
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    4312 (MMP1)
  Endocrine system
   03320 PPAR signaling pathway
    4312 (MMP1)
   04926 Relaxin signaling pathway
    4312 (MMP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4312 (MMP1)
   05219 Bladder cancer
    4312 (MMP1)
  Immune diseases
   05323 Rheumatoid arthritis
    4312 (MMP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     4312 (MMP1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4312 (MMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Reprolysin_4 Peptidase_M54 Peptidase_M66 DUF4953 FSAP_sig_propep Metallopep
Motif
Other DBs
NCBI-GeneID: 4312
NCBI-ProteinID: NP_002412
OMIM: 120353
HGNC: 7155
Ensembl: ENSG00000196611
Vega: OTTHUMG00000048192
Pharos: P03956(Tclin)
UniProt: P03956 Q53G95
Structure
PDB: 

Jmol
Position
11q22.2
AA seq 469 aa AA seqDB search
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctttcctccactgctgctgctgctgttctggggtgtggtgtctcacagcttc
ccagcgactctagaaacacaagagcaagatgtggacttagtccagaaatacctggaaaaa
tactacaacctgaagaatgatgggaggcaagttgaaaagcggagaaatagtggcccagtg
gttgaaaaattgaagcaaatgcaggaattctttgggctgaaagtgactgggaaaccagat
gctgaaaccctgaaggtgatgaagcagcccagatgtggagtgcctgatgtggctcagttt
gtcctcactgaggggaaccctcgctgggagcaaacacatctgacctacaggattgaaaat
tacacgccagatttgccaagagcagatgtggaccatgccattgagaaagccttccaactc
tggagtaatgtcacacctctgacattcaccaaggtctctgagggtcaagcagacatcatg
atatcttttgtcaggggagatcatcgggacaactctccttttgatggacctggaggaaat
cttgctcatgcttttcaaccaggcccaggtattggaggggatgctcattttgatgaagat
gaaaggtggaccaacaatttcagagagtacaacttacatcgtgttgcagctcatgaactc
ggccattctcttggactctcccattctactgatatcggggctttgatgtaccctagctac
accttcagtggtgatgttcagctagctcaggatgacattgatggcatccaagccatatat
ggacgttcccaaaatcctgtccagcccatcggcccacaaaccccaaaagcgtgtgacagt
aagctaacctttgatgctataactacgattcggggagaagtgatgttctttaaagacaga
ttctacatgcgcacaaatcccttctacccggaagttgagctcaatttcatttctgttttc
tggccacaactgccaaatgggcttgaagctgcttacgaatttgccgacagagatgaagtc
cggtttttcaaagggaataagtactgggctgttcagggacagaatgtgctacacggatac
cccaaggacatctacagctcctttggcttccctagaactgtgaagcatatcgatgctgct
ctttctgaggaaaacactggaaaaacctacttctttgttgctaacaaatactggaggtat
gatgaatataaacgatctatggatccaggttatcccaaaatgatagcacatgactttcct
ggaattggccacaaagttgatgcagttttcatgaaagatggatttttctatttctttcat
ggaacaagacaatacaaatttgatcctaaaacgaagagaattttgactctccagaaagct
aatagctggttcaactgcaggaaaaattga

DBGET integrated database retrieval system