KEGG   Homo sapiens (human): 4312Help
Entry
4312              CDS       T01001                                 

Gene name
MMP1, CLG, CLGN
Definition
(RefSeq) matrix metallopeptidase 1 (EC:3.4.24.7)
  KO
K01388  
matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Pathways in cancer
Bladder cancer
Rheumatoid arthritis
Disease
H00028  
Choriocarcinoma
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4312 (MMP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4312 (MMP1)
   05219 Bladder cancer
    4312 (MMP1)
  Immune diseases
   05323 Rheumatoid arthritis
    4312 (MMP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     4312 (MMP1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4312 (MMP1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-2
    ITGB1; integrin beta 1 [KO:K05719]
     4312 (MMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 469 aa AA seqDB search
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctttcctccactgctgctgctgctgttctggggtgtggtgtctcacagcttc
ccagcgactctagaaacacaagagcaagatgtggacttagtccagaaatacctggaaaaa
tactacaacctgaagaatgatgggaggcaagttgaaaagcggagaaatagtggcccagtg
gttgaaaaattgaagcaaatgcaggaattctttgggctgaaagtgactgggaaaccagat
gctgaaaccctgaaggtgatgaagcagcccagatgtggagtgcctgatgtggctcagttt
gtcctcactgaggggaaccctcgctgggagcaaacacatctgacctacaggattgaaaat
tacacgccagatttgccaagagcagatgtggaccatgccattgagaaagccttccaactc
tggagtaatgtcacacctctgacattcaccaaggtctctgagggtcaagcagacatcatg
atatcttttgtcaggggagatcatcgggacaactctccttttgatggacctggaggaaat
cttgctcatgcttttcaaccaggcccaggtattggaggggatgctcattttgatgaagat
gaaaggtggaccaacaatttcagagagtacaacttacatcgtgttgcagctcatgaactc
ggccattctcttggactctcccattctactgatatcggggctttgatgtaccctagctac
accttcagtggtgatgttcagctagctcaggatgacattgatggcatccaagccatatat
ggacgttcccaaaatcctgtccagcccatcggcccacaaaccccaaaagcgtgtgacagt
aagctaacctttgatgctataactacgattcggggagaagtgatgttctttaaagacaga
ttctacatgcgcacaaatcccttctacccggaagttgagctcaatttcatttctgttttc
tggccacaactgccaaatgggcttgaagctgcttacgaatttgccgacagagatgaagtc
cggtttttcaaagggaataagtactgggctgttcagggacagaatgtgctacacggatac
cccaaggacatctacagctcctttggcttccctagaactgtgaagcatatcgatgctgct
ctttctgaggaaaacactggaaaaacctacttctttgttgctaacaaatactggaggtat
gatgaatataaacgatctatggatccaggttatcccaaaatgatagcacatgactttcct
ggaattggccacaaagttgatgcagttttcatgaaagatggatttttctatttctttcat
ggaacaagacaatacaaatttgatcctaaaacgaagagaattttgactctccagaaagct
aatagctggttcaactgcaggaaaaattga

DBGET integrated database retrieval system