KEGG   Homo sapiens (human): 4313Help
Entry
4313              CDS       T01001                                 

Gene name
MMP2, CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
Definition
(RefSeq) matrix metallopeptidase 2 (EC:3.4.24.24)
  KO
K01398  
matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Leukocyte transendothelial migration
GnRH signaling pathway
Estrogen signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Proteoglycans in cancer
Bladder cancer
Disease
H00025  
Penile cancer
H00028  
Choriocarcinoma
H00472  
Torg-Winchester syndrome
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4313 (MMP2)
  Endocrine system
   04912 GnRH signaling pathway
    4313 (MMP2)
   04915 Estrogen signaling pathway
    4313 (MMP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4313 (MMP2)
   05205 Proteoglycans in cancer
    4313 (MMP2)
   05219 Bladder cancer
    4313 (MMP2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4313 (MMP2)
  Antineoplastic resistance
   01522 Endocrine resistance
    4313 (MMP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     4313 (MMP2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4313 (MMP2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta3 integrins
   VNR
    ITGB3; integrin beta 3 [KO:K06493]
     4313 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q12.2
AA seq 660 aa AA seqDB search
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctaatggcccggggcgcgctcacgggtcccctgagggcgctctgtctcctg
ggctgcctgctgagccacgccgccgccgcgccgtcgcccatcatcaagttccccggcgat
gtcgcccccaaaacggacaaagagttggcagtgcaatacctgaacaccttctatggctgc
cccaaggagagctgcaacctgtttgtgctgaaggacacactaaagaagatgcagaagttc
tttggactgccccagacaggtgatcttgaccagaataccatcgagaccatgcggaagcca
cgctgcggcaacccagatgtggccaactacaacttcttccctcgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggctacacacctgatctggacccagagacagtg
gatgatgcctttgctcgtgccttccaagtctggagcgatgtgaccccactgcggttttct
cgaatccatgatggagaggcagacatcatgatcaactttggccgctgggagcatggcgat
ggatacccctttgacggtaaggacggactcctggctcatgccttcgccccaggcactggt
gttgggggagactcccattttgatgacgatgagctatggaccttgggagaaggccaagtg
gtccgtgtgaagtatgggaacgccgatggggagtactgcaagttccccttcttgttcaat
ggcaaggagtacaacagctgcactgataccggccgcagcgatggcttcctctggtgctcc
accacctacaactttgagaaggatggcaagtacggcttctgtccccatgaagccctgttc
accatgggcggcaacgctgaaggacagccctgcaagtttccattccgcttccagggcaca
tcctatgacagctgcaccactgagggccgcacggatggctaccgctggtgcggcaccact
gaggactacgaccgcgacaagaagtatggcttctgccctgagaccgccatgtccactgtt
ggtgggaactcagaaggtgccccctgtgtcttccccttcactttcctgggcaacaaatat
gagagctgcaccagcgccggccgcagtgacggaaagatgtggtgtgcgaccacagccaac
tacgatgatgaccgcaagtggggcttctgccctgaccaagggtacagcctgttcctcgtg
gcagcccacgagtttggccacgccatggggctggagcactcccaagaccctggggccctg
atggcacccatttacacctacaccaagaacttccgtctgtcccaggatgacatcaagggc
attcaggagctctatggggcctctcctgacattgaccttggcaccggccccacccccacg
ctgggccctgtcactcctgagatctgcaaacaggacattgtatttgatggcatcgctcag
atccgtggtgagatcttcttcttcaaggaccggttcatttggcggactgtgacgccacgt
gacaagcccatggggcccctgctggtggccacattctggcctgagctcccggaaaagatt
gatgcggtatacgaggccccacaggaggagaaggctgtgttctttgcagggaatgaatac
tggatctactcagccagcaccctggagcgagggtaccccaagccactgaccagcctggga
ctgccccctgatgtccagcgagtggatgccgcctttaactggagcaaaaacaagaagaca
tacatctttgctggagacaaattctggagatacaatgaggtgaagaagaaaatggatcct
ggcttccccaagctcatcgcagatgcctggaatgccatccccgataacctggatgccgtc
gtggacctgcagggcggcggtcacagctacttcttcaagggtgcctattacctgaagctg
gagaaccaaagtctgaagagcgtgaagtttggaagcatcaaatccgactggctaggctgc
tga

DBGET integrated database retrieval system