KEGG   Homo sapiens (human): 4313Help
Entry
4313              CDS       T01001                                 

Gene name
MMP2, CLG4, CLG4A, MMP-II, MONA, TBE-1
Definition
matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) (EC:3.4.24.24)
Orthology
K01398  
matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
GnRH signaling pathway
Estrogen signaling pathway
Pathways in cancer
Proteoglycans in cancer
Bladder cancer
Disease
H00025  
Penile cancer
H00028  
Choriocarcinoma
H00472  
Torg-Winchester syndrome
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4313 (MMP2)
  Endocrine system
   04912 GnRH signaling pathway
    4313 (MMP2)
   04915 Estrogen signaling pathway
    4313 (MMP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4313 (MMP2)
   05205 Proteoglycans in cancer
    4313 (MMP2)
   05219 Bladder cancer
    4313 (MMP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     4313 (MMP2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4313 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q13-q21
AA seq 610 aa AA seqDB search
MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY
NFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM
INFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADG
EYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQP
CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV
FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMG
LEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICK
QDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE
KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWR
YNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKF
GSIKSDWLGC
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacctgaacaccttctatggctgccccaaggagagctgcaacctgtttgtgctg
aaggacacactaaagaagatgcagaagttctttggactgccccagacaggtgatcttgac
cagaataccatcgagaccatgcggaagccacgctgcggcaacccagatgtggccaactac
aacttcttccctcgcaagcccaagtgggacaagaaccagatcacatacaggatcattggc
tacacacctgatctggacccagagacagtggatgatgcctttgctcgtgccttccaagtc
tggagcgatgtgaccccactgcggttttctcgaatccatgatggagaggcagacatcatg
atcaactttggccgctgggagcatggcgatggatacccctttgacggtaaggacggactc
ctggctcatgccttcgccccaggcactggtgttgggggagactcccattttgatgacgat
gagctatggaccttgggagaaggccaagtggtccgtgtgaagtatgggaacgccgatggg
gagtactgcaagttccccttcttgttcaatggcaaggagtacaacagctgcactgatacc
ggccgcagcgatggcttcctctggtgctccaccacctacaactttgagaaggatggcaag
tacggcttctgtccccatgaagccctgttcaccatgggcggcaacgctgaaggacagccc
tgcaagtttccattccgcttccagggcacatcctatgacagctgcaccactgagggccgc
acggatggctaccgctggtgcggcaccactgaggactacgaccgcgacaagaagtatggc
ttctgccctgagaccgccatgtccactgttggtgggaactcagaaggtgccccctgtgtc
ttccccttcactttcctgggcaacaaatatgagagctgcaccagcgccggccgcagtgac
ggaaagatgtggtgtgcgaccacagccaactacgatgatgaccgcaagtggggcttctgc
cctgaccaagggtacagcctgttcctcgtggcagcccacgagtttggccacgccatgggg
ctggagcactcccaagaccctggggccctgatggcacccatttacacctacaccaagaac
ttccgtctgtcccaggatgacatcaagggcattcaggagctctatggggcctctcctgac
attgaccttggcaccggccccacccccacgctgggccctgtcactcctgagatctgcaaa
caggacattgtatttgatggcatcgctcagatccgtggtgagatcttcttcttcaaggac
cggttcatttggcggactgtgacgccacgtgacaagcccatggggcccctgctggtggcc
acattctggcctgagctcccggaaaagattgatgcggtatacgaggccccacaggaggag
aaggctgtgttctttgcagggaatgaatactggatctactcagccagcaccctggagcga
gggtaccccaagccactgaccagcctgggactgccccctgatgtccagcgagtggatgcc
gcctttaactggagcaaaaacaagaagacatacatctttgctggagacaaattctggaga
tacaatgaggtgaagaagaaaatggatcctggcttccccaagctcatcgcagatgcctgg
aatgccatccccgataacctggatgccgtcgtggacctgcagggcggcggtcacagctac
ttcttcaagggtgcctattacctgaagctggagaaccaaagtctgaagagcgtgaagttt
ggaagcatcaaatccgactggctaggctgctga

DBGET integrated database retrieval system