KEGG   Homo sapiens (human): 4316Help
Entry
4316              CDS       T01001                                 

Gene name
MMP7, MMP-7, MPSL1, PUMP-1
Definition
matrix metallopeptidase 7 (matrilysin, uterine) (EC:3.4.24.23)
Orthology
K01397  
matrix metalloproteinase-7 (matrilysin, uterine) [EC:3.4.24.23]
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4316 (MMP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.23  matrilysin
     4316 (MMP7)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4316 (MMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q21-q22
AA seq 267 aa AA seqDB search
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcaccgtgctgtgtgctgtgtgcctgctgcctggcagcctggccctgccgctg
cctcaggaggcgggaggcatgagtgagctacagtgggaacaggctcaggactatctcaag
agattttatctctatgactcagaaacaaaaaatgccaacagtttagaagccaaactcaag
gagatgcaaaaattctttggcctacctataactggaatgttaaactcccgcgtcatagaa
ataatgcagaagcccagatgtggagtgccagatgttgcagaatactcactatttccaaat
agcccaaaatggacttccaaagtggtcacctacaggatcgtatcatatactcgagactta
ccgcatattacagtggatcgattagtgtcaaaggctttaaacatgtggggcaaagagatc
cccctgcatttcaggaaagttgtatggggaactgctgacatcatgattggctttgcgcga
ggagctcatggggactcctacccatttgatgggccaggaaacacgctggctcatgccttt
gcgcctgggacaggtctcggaggagatgctcacttcgatgaggatgaacgctggacggat
ggtagcagtctagggattaacttcctgtatgctgcaactcatgaacttggccattctttg
ggtatgggacattcctctgatcctaatgcagtgatgtatccaacctatggaaatggagat
ccccaaaattttaaactttcccaggatgatattaaaggcattcagaaactatatggaaag
agaagtaattcaagaaagaaatag

DBGET integrated database retrieval system