KEGG   Homo sapiens (human): 4318Help
Entry
4318              CDS       T01001                                 

Gene name
MMP9, CLG4B, GELB, MANDP2, MMP-9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04915  Estrogen signaling pathway
hsa04926  Relaxin signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05219  Bladder cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
Disease
H00025  Penile cancer
H00479  Metaphyseal dysplasias
Drug target
Batimastat: D03061
Ilomastat: D03793
Marimastat: D03795
Prinomastat: D03797
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    4318 (MMP9)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    4318 (MMP9)
   04670 Leukocyte transendothelial migration
    4318 (MMP9)
  Endocrine system
   04915 Estrogen signaling pathway
    4318 (MMP9)
   04926 Relaxin signaling pathway
    4318 (MMP9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4318 (MMP9)
   05202 Transcriptional misregulation in cancers
    4318 (MMP9)
   05206 MicroRNAs in cancer
    4318 (MMP9)
   05205 Proteoglycans in cancer
    4318 (MMP9)
   05219 Bladder cancer
    4318 (MMP9)
   05215 Prostate cancer
    4318 (MMP9)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4318 (MMP9)
  Infectious diseases
   05161 Hepatitis B
    4318 (MMP9)
  Drug resistance
   01522 Endocrine resistance
    4318 (MMP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     4318 (MMP9)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4318 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66
Motif
Other DBs
NCBI-GeneID: 4318
NCBI-ProteinID: NP_004985
OMIM: 120361
HGNC: 7176
Ensembl: ENSG00000100985
Vega: OTTHUMG00000033044
Pharos: P14780(Tchem)
UniProt: P14780
Structure
PDB: 

Jmol
Position
20q13.12
AA seq 707 aa AA seqDB search
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

DBGET integrated database retrieval system