KEGG   Homo sapiens (human): 4318Help
Entry
4318              CDS       T01001                                 

Gene name
MMP9, CLG4B, GELB, MANDP2, MMP-9
Definition
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (EC:3.4.24.35)
Orthology
K01403  
matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
Leukocyte transendothelial migration
Estrogen signaling pathway
Hepatitis B
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Disease
H00025  
Penile cancer
H00479  
Metaphyseal dysplasias
Drug target
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2-q13.1
AA seq 707 aa AA seqDB search
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

DBGET integrated database retrieval system