KEGG   Homo sapiens (human): 4318Help
Entry
4318              CDS       T01001                                 

Gene name
MMP9, CLG4B, GELB, MANDP2, MMP-9
Definition
matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (EC:3.4.24.35)
Orthology
K01403  
matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
Leukocyte transendothelial migration
Estrogen signaling pathway
Hepatitis B
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Disease
H00025  
Penile cancer
H00479  
Metaphyseal dysplasias
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    4318 (MMP9)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4318 (MMP9)
  Endocrine system
   04915 Estrogen signaling pathway
    4318 (MMP9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4318 (MMP9)
   05202 Transcriptional misregulation in cancers
    4318 (MMP9)
   05206 MicroRNAs in cancer
    4318 (MMP9)
   05205 Proteoglycans in cancer
    4318 (MMP9)
   05219 Bladder cancer
    4318 (MMP9)
  Infectious diseases
   05161 Hepatitis B
    4318 (MMP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     4318 (MMP9)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4318 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2-q13.1
AA seq 707 aa AA seqDB search
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

  All links  
No link information was found.   
DBGET integrated database retrieval system