KEGG   Homo sapiens (human): 438Help
Entry
438               CDS       T01001                                 

Gene name
ASMT, ASMTY, HIOMT, HIOMTY
Definition
acetylserotonin O-methyltransferase (EC:2.1.1.4)
Orthology
K00543  
acetylserotonin N-methyltransferase [EC:2.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Metabolic pathways
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    438 (ASMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.4  acetylserotonin O-methyltransferase
     438 (ASMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.3 or Yp11.3
AA seq 373 aa AA seqDB search
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGT
ELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHL
ADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVF
PLMCDLGGTWIKLETIILSKLSQGQKTKHRVFSLIGGAGALAKECMSLYPGCKITVFDIP
EVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHT
CKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFK
KTGAIYDAILARK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggatcctcagaggaccaggcctatcgcctccttaatgactacgccaacggcttcatg
gtgtcccaggttctcttcgccgcctgcgagctgggcgtgtttgaccttctcgccgaggcc
ccagggcccctggacgtggcggcagtggctgcaggtgtgagggccagcgcccatgggaca
gagctcctgctggacatctgtgtgtccctgaagctgctgaaagtggagacgaggggagga
aaagctttctatcgaaacacagagctgtccagcgactacctgaccacggtcagcccgacg
tcacaatgcagcatgctgaagtacatgggcaggaccagctaccggtgctggggccacctg
gcagacgccgtgagagaaggaaggaaccagtacctggagacgtttggcgttcccgctgaa
gagctttttacggccatctacaggtccgagggcgagcggctacagttcatgcaagctctg
caggaggtctggagcgtcaacgggagaagcgtgctgaccgcctttgacctgtcagtgttc
ccacttatgtgtgaccttggtgggacatggataaagctggaaaccatcattctcagcaaa
ctatcgcaaggacagaaaaccaaacaccgcgtgttctcactcataggtggggctggagct
ctggctaaggaatgcatgtctctgtaccctggatgtaagatcaccgtttttgacatccca
gaagtggtgtggacggcaaagcagcacttctcattccaggaggaagaacagattgacttc
caggaaggggatttcttcaaagaccctcttccggaagctgatctgtacatcctggccagg
gtcctccatgactgggcagacggaaagtgctcacacctgctggagaggatctaccacact
tgcaagccaggtggtggcattctggtaattgaaagcctcctggatgaagacaggcgaggt
cctctgctcacgcagctctactctctgaacatgcttgtgcagacggaagggcaggagagg
acccccacccactaccacatgctcctctcttctgctggcttcagagacttccagtttaag
aaaacaggagccatttatgatgccattttagccaggaaataa

DBGET integrated database retrieval system