KEGG   Homo sapiens (human): 445Help
Entry
445               CDS       T01001                                 

Gene name
ASS1, ASS, CTLN1
Definition
argininosuccinate synthase 1 (EC:6.3.4.5)
Orthology
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Disease
H00185  
Citrullinemia (CTLN)
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 412 aa AA seqDB search
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaggctccgtggttctggcctacagtggcggcctggacacctcgtgcatc
ctcgtgtggctgaaggaacaaggctatgacgtcattgcctatctggccaacattggccag
aaggaagacttcgaggaagccaggaagaaggcactgaagcttggggccaaaaaggtgttc
attgaggatgtcagcagggagtttgtggaggagttcatctggccggccatccagtccagc
gcactgtatgaggaccgctacctcctgggcacctctcttgccaggccctgcatcgcccgc
aaacaagtggaaatcgcccagcgggagggggccaagtatgtgtcccacggcgccacagga
aaggggaacgatcaggtccggtttgagctcagctgctactcactggccccccagataaag
gtcattgctccctggaggatgcctgaattctacaaccggttcaagggccgcaatgacctg
atggagtacgcaaagcaacacgggattcccatcccggtcactcccaagaacccgtggagc
atggatgagaacctcatgcacatcagctacgaggctggaatcctggagaaccccaagaac
caagcgcctccaggtctctacacgaagacccaggacccagccaaagcccccaacacccct
gacattctcgagatcgagttcaaaaaaggggtccctgtgaaggtgaccaacgtcaaggat
ggcaccacccaccagacctccttggagctcttcatgtacctgaacgaagtcgcgggcaag
catggcgtgggccgtattgacatcgtggagaaccgcttcattggaatgaagtcccgaggt
atctacgagaccccagcaggcaccatcctttaccatgctcatttagacatcgaggccttc
accatggaccgggaagtgcgcaaaatcaaacaaggcctgggcttgaaatttgctgagctg
gtgtataccggtttctggcacagccctgagtgtgaatttgtccgccactgcatcgccaag
tcccaggagcgagtggaagggaaagtgcaggtgtccgtcctcaagggccaggtgtacatc
ctcggccgggagtccccactgtctctctacaatgaggagctggtgagcatgaacgtgcag
ggtgattatgagccaactgatgccaccgggttcatcaacatcaattccctcaggctgaag
gaatatcatcgtctccagagcaaggtcactgccaaatag

DBGET integrated database retrieval system