KEGG   Homo sapiens (human): 445Help
Entry
445               CDS       T01001                                 

Gene name
ASS1, ASS, CTLN1
Definition
(RefSeq) argininosuccinate synthase 1
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of amino acids
Fluid shear stress and atherosclerosis
Module
Urea cycle
Arginine biosynthesis, ornithine => arginine
Disease
H00185  
Citrullinemia (CTLN)
H01398  
Primary hyperammonemic disorders (Urea cycle disorders)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    445 (ASS1)
   00220 Arginine biosynthesis
    445 (ASS1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    445 (ASS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     445 (ASS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   445 (ASS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P00966(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.11
AA seq 412 aa AA seqDB search
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaggctccgtggttctggcctacagtggcggcctggacacctcgtgcatc
ctcgtgtggctgaaggaacaaggctatgacgtcattgcctatctggccaacattggccag
aaggaagacttcgaggaagccaggaagaaggcactgaagcttggggccaaaaaggtgttc
attgaggatgtcagcagggagtttgtggaggagttcatctggccggccatccagtccagc
gcactgtatgaggaccgctacctcctgggcacctctcttgccaggccctgcatcgcccgc
aaacaagtggaaatcgcccagcgggagggggccaagtatgtgtcccacggcgccacagga
aaggggaacgatcaggtccggtttgagctcagctgctactcactggccccccagataaag
gtcattgctccctggaggatgcctgaattctacaaccggttcaagggccgcaatgacctg
atggagtacgcaaagcaacacgggattcccatcccggtcactcccaagaacccgtggagc
atggatgagaacctcatgcacatcagctacgaggctggaatcctggagaaccccaagaac
caagcgcctccaggtctctacacgaagacccaggacccagccaaagcccccaacacccct
gacattctcgagatcgagttcaaaaaaggggtccctgtgaaggtgaccaacgtcaaggat
ggcaccacccaccagacctccttggagctcttcatgtacctgaacgaagtcgcgggcaag
catggcgtgggccgtattgacatcgtggagaaccgcttcattggaatgaagtcccgaggt
atctacgagaccccagcaggcaccatcctttaccatgctcatttagacatcgaggccttc
accatggaccgggaagtgcgcaaaatcaaacaaggcctgggcttgaaatttgctgagctg
gtgtataccggtttctggcacagccctgagtgtgaatttgtccgccactgcatcgccaag
tcccaggagcgagtggaagggaaagtgcaggtgtccgtcctcaagggccaggtgtacatc
ctcggccgggagtccccactgtctctctacaatgaggagctggtgagcatgaacgtgcag
ggtgattatgagccaactgatgccaccgggttcatcaacatcaattccctcaggctgaag
gaatatcatcgtctccagagcaaggtcactgccaaatag

DBGET integrated database retrieval system