KEGG   Homo sapiens (human): 4478Help
Entry
4478              CDS       T01001                                 

Gene name
MSN, HEL70
Definition
moesin
Orthology
K05763  
moesin
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Measles
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4478 (MSN)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4478 (MSN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    4478 (MSN)
  Infectious diseases
   05162 Measles
    4478 (MSN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4478 (MSN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq11.1
AA seq 577 aa AA seqDB search
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaacgatcagtgtgcgtgtgaccaccatggatgcagagctggagtttgccatc
cagcccaacaccaccgggaagcagctatttgaccaggtggtgaaaactattggcttgagg
gaagtttggttctttggtctgcagtaccaggacactaaaggtttctccacctggctgaaa
ctcaataagaaggtgactgcccaggatgtgcggaaggaaagccccctgctctttaagttc
cgtgccaagttctaccctgaggatgtgtccgaggaattgattcaggacatcactcagcgc
ctgttctttctgcaagtgaaagagggcattctcaatgatgatatttactgcccgcctgag
accgctgtgctgctggcctcgtatgctgtccagtctaagtatggcgacttcaataaggaa
gtgcataagtctggctacctggccggagacaagttgctcccgcagagagtcctggaacag
cacaaactcaacaaggaccagtgggaggagcggatccaggtgtggcatgaggaacaccgt
ggcatgctcagggaggatgctgtcctggaatatctgaagattgctcaagatctggagatg
tatggtgtgaactacttcagcatcaagaacaagaaaggctcagagctgtggctgggggtg
gatgccctgggtctcaacatctatgagcagaatgacagactaactcccaagataggcttc
ccctggagtgaaatcaggaacatctctttcaatgataagaaatttgtcatcaagcccatt
gacaaaaaagccccggacttcgtcttctatgctccccggctgcggattaacaagcggatc
ttggccttgtgcatggggaaccatgaactatacatgcgccgtcgcaagcctgataccatt
gaggtgcagcagatgaaggcacaggcccgggaggagaagcaccagaagcagatggagcgt
gctatgctggaaaatgagaagaagaagcgtgaaatggcagagaaggagaaagagaagatt
gaacgggagaaggaggagctgatggagaggctgaagcagatcgaggaacagactaagaag
gctcagcaagaactggaagaacagacccgtagggctctggaacttgagcaggaacggaag
cgtgcccagagcgaggctgaaaagctggccaaggagcgtcaagaagctgaagaggccaag
gaggccttgctgcaggcctcccgggaccagaaaaagactcaggaacagctggccttggaa
atggcagagctgacagctcgaatctcccagctggagatggcccgacagaagaaggagagt
gaggctgtggagtggcagcagaaggcccagatggtacaggaagacttggagaagacccgt
gctgagctgaagactgccatgagtacacctcatgtggcagagcctgctgagaatgagcag
gatgagcaggatgagaatggggcagaggctagtgctgacctacgggctgatgctatggcc
aaggaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
cacctgaaggccctcacttcggagctggccaatgccagagatgagtccaagaagactgcc
aatgacatgatccatgctgagaacatgcgactgggccgagacaaatacaagaccctgcgc
cagatccggcagggcaacaccaagcagcgcattgacgaatttgagtctatgtaa

DBGET integrated database retrieval system