KEGG   Homo sapiens (human): 4512Help
Entry
4512              CDS       T01001                                 

Gene name
COX1, COI, MTCO1, MT-CO1
Definition
cytochrome c oxidase subunit I
Orthology
K02256  
cytochrome c oxidase subunit 1 [EC:1.9.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Disease
H00068  
Leber optic atrophy
H01368  
Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4512 (COX1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4512 (COX1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4512 (COX1)
   05012 Parkinson's disease
    4512 (COX1)
   05016 Huntington's disease
    4512 (COX1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4512 (COX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     4512 (COX1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4512 (COX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Position
MT
AA seq 513 aa AA seqDB search
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEA
GAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG
VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR
KVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgaccgttgactattctctacaaaccacaaagacattggaacactataccta
ttattcggcgcatgagctggagtcctaggcacagctctaagcctccttattcgagccgag
ctgggccagccaggcaaccttctaggtaacgaccacatctacaacgttatcgtcacagcc
catgcatttgtaataatcttcttcatagtaatacccatcataatcggaggctttggcaac
tgactagttcccctaataatcggtgcccccgatatggcgtttccccgcataaacaacata
agcttctgactcttacctccctctctcctactcctgctcgcatctgctatagtggaggcc
ggagcaggaacaggttgaacagtctaccctcccttagcagggaactactcccaccctgga
gcctccgtagacctaaccatcttctccttacacctagcaggtgtctcctctatcttaggg
gccatcaatttcatcacaacaattatcaatataaaaccccctgccataacccaataccaa
acgcccctcttcgtctgatccgtcctaatcacagcagtcctacttctcctatctctccca
gtcctagctgctggcatcactatactactaacagaccgcaacctcaacaccaccttcttc
gaccccgccggaggaggagaccccattctataccaacacctattctgatttttcggtcac
cctgaagtttatattcttatcctaccaggcttcggaataatctcccatattgtaacttac
tactccggaaaaaaagaaccatttggatacataggtatggtctgagctatgatatcaatt
ggcttcctagggtttatcgtgtgagcacaccatatatttacagtaggaatagacgtagac
acacgagcatatttcacctccgctaccataatcatcgctatccccaccggcgtcaaagta
tttagctgactcgccacactccacggaagcaatatgaaatgatctgctgcagtgctctga
gccctaggattcatctttcttttcaccgtaggtggcctgactggcattgtattagcaaac
tcatcactagacatcgtactacacgacacgtactacgttgtagcccacttccactatgtc
ctatcaataggagctgtatttgccatcataggaggcttcattcactgatttcccctattc
tcaggctacaccctagaccaaacctacgccaaaatccatttcactatcatattcatcggc
gtaaatctaactttcttcccacaacactttctcggcctatccggaatgccccgacgttac
tcggactaccccgatgcatacaccacatgaaacatcctatcatctgtaggctcattcatt
tctctaacagcagtaatattaataattttcatgatttgagaagccttcgcttcgaagcga
aaagtcctaatagtagaagaaccctccataaacctggagtgactatatggatgcccccca
ccctaccacacattcgaagaacccgtatacataaaatctaga

DBGET integrated database retrieval system