KEGG   Homo sapiens (human): 4519Help
Entry
4519              CDS       T01001                                 

Gene name
CYTB, MTCYB, MT-CYB
Definition
(RefSeq) cytochrome b
  KO
K00412  
ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome bc1 complex respiratory unit
Cytochrome bc1 complex
Disease
H00068  
Leber hereditary optic atrophy (LHON)
H00473  
Mitochondrial respiratory chain deficiencies (MRCD)
H01355  
Kearns-Sayre Syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4519 (CYTB)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4519 (CYTB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4519 (CYTB)
   05012 Parkinson's disease
    4519 (CYTB)
   05016 Huntington's disease
    4519 (CYTB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4519 (CYTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    4519 (CYTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Pharos: 
P00156(Tbio)
UniProt: 
Position
MT
AA seq 380 aa AA seqDB search
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
NT seq 1141 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatacgcaaaactaaccccctaataaaattaattaaccactcattcatcgac
ctccccaccccatccaacatctccgcatgatgaaacttcggctcactccttggcgcctgc
ctgatcctccaaatcaccacaggactattcctagccatgcactactcaccagacgcctca
accgccttttcatcaatcgcccacatcactcgagacgtaaattatggctgaatcatccgc
taccttcacgccaatggcgcctcaatattctttatctgcctcttcctacacatcgggcga
ggcctatattacggatcatttctctactcagaaacctgaaacatcggcattatcctcctg
cttgcaactatagcaacagccttcataggctatgtcctcccgtgaggccaaatatcattc
tgaggggccacagtaattacaaacttactatccgccatcccatacattgggacagaccta
gttcaatgaatctgaggaggctactcagtagacagtcccaccctcacacgattctttacc
tttcacttcatcttgcccttcattattgcagccctagcaacactccacctcctattcttg
cacgaaacgggatcaaacaaccccctaggaatcacctcccattccgataaaatcaccttc
cacccttactacacaatcaaagacgccctcggcttacttctcttccttctctccttaatg
acattaacactattctcaccagacctcctaggcgacccagacaattataccctagccaac
cccttaaacacccctccccacatcaagcccgaatgatatttcctattcgcctacacaatt
ctccgatccgtccctaacaaactaggaggcgtccttgccctattactatccatcctcatc
ctagcaataatccccatcctccatatatccaaacaacaaagcataatatttcgcccacta
agccaatcactttattgactcctagccgcagacctcctcattctaacctgaatcggagga
caaccagtaagctacccttttaccatcattggacaagtagcatccgtactatacttcaca
acaatcctaatcctaataccaactatctccctaattgaaaacaaaatactcaaatgggcc
t

DBGET integrated database retrieval system