KEGG   Homo sapiens (human): 4582Help
Entry
4582              CDS       T01001                                 

Gene name
MUC1, ADMCKD, ADMCKD1, CA_15-3, CD227, EMA, H23AG, KL-6, MAM6, MCD, MCKD, MCKD1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM
Definition
mucin 1, cell surface associated
Orthology
K06568  
mucin 1, transmembrane
Organism
hsa  Homo sapiens (human)
Drug target
Technetium (99mTc) arcitumomab: 
Other: 
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4582 (MUC1)
  Exosomal proteins of breast cancer cells
   4582 (MUC1)
  Exosomal proteins of bladder cancer cells
   4582 (MUC1)
Cellular antigens [BR:hsa04090]
 Proteins
  4582 (MUC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Structure
PDB: 

Jmol
Position
1q21
AA seq 264 aa AA seqDB search
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK
NAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGT
INVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV
ALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEK
VSAGNGGSSLSYTNPAVAATSANL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgggcacccagtctcctttcttcctgctgctgctcctcacagtgcttacagct
accacagcccctaaacccgcaacagttgttacgggttctggtcatgcaagctctacccca
ggtggagaaaaggagacttcggctacccagagaagttcagtgcccagctctactgagaag
aatgcttttaattcctctctggaagatcccagcaccgactactaccaagagctgcagaga
gacatttctgaaatgtttttgcagatttataaacaagggggttttctgggcctctccaat
attaagttcaggccaggatctgtggtggtacaattgactctggccttccgagaaggtacc
atcaatgtccacgacgtggagacacagttcaatcagtataaaacggaagcagcctctcga
tataacctgacgatctcagacgtcagcgtgagtgatgtgccatttcctttctctgcccag
tctggggctggggtgccaggctggggcatcgcgctgctggtgctggtctgtgttctggtt
gcgctggccattgtctatctcattgccttggctgtctgtcagtgccgccgaaagaactac
gggcagctggacatctttccagcccgggatacctaccatcctatgagcgagtaccccacc
taccacacccatgggcgctatgtgccccctagcagtaccgatcgtagcccctatgagaag
gtttctgcaggtaatggtggcagcagcctctcttacacaaacccagcagtggcagccact
tctgccaacttgtag

DBGET integrated database retrieval system