KEGG   Homo sapiens (human): 4607Help
Entry
4607              CDS       T01001                                 

Gene name
MYBPC3, CMD1MM, CMH4, FHC, LVNC10, MYBP-C
Definition
myosin binding protein C, cardiac
Orthology
K12568  
myosin-binding protein C, cardiac-type
Organism
hsa  Homo sapiens (human)
Pathway
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
Class
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 1274 aa AA seqDB search
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA
PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE
VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK
KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK
KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT
LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE
GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV
QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK
LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV
VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE
TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI
SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV
VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG
LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE
PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS
IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL
NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF
SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML
CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG
EARCECRLEVRVPQ
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccggggaagaagccagtctcagcttttagcaagaagccacggtcagtggaa
gtggccgcaggcagccctgccgtgttcgaggccgagacagagcgggcaggagtgaaggtg
cgctggcagcgcggaggcagtgacatcagcgccagcaacaagtacggcctggccacagag
ggcacacggcatacgctgacagtgcgggaagtgggccctgccgaccagggatcttacgca
gtcattgctggctcctccaaggtcaagttcgacctcaaggtcatagaggcagagaaggca
gagcccatgctggcccctgcccctgcccctgctgaggccactggagcccctggagaagcc
ccggccccagccgctgagctgggagaaagtgccccaagtcccaaagggtcaagctcagca
gctctcaatggtcctacccctggagcccccgatgaccccattggcctcttcgtgatgcgg
ccacaggatggcgaggtgaccgtgggtggcagcatcaccttctcagcccgcgtggccggc
gccagcctcctgaagccgcctgtggtcaagtggttcaagggcaaatgggtggacctgagc
agcaaggtgggccagcacctgcagctgcacgacagctacgaccgcgccagcaaggtctat
ctgttcgagctgcacatcaccgatgcccagcctgccttcactggcagctaccgctgtgag
gtgtccaccaaggacaaatttgactgctccaacttcaatctcactgtccacgaggccatg
ggcaccggagacctggacctcctatcagccttccgccgcacgagcctggctggaggtggt
cggcggatcagtgatagccatgaggacactgggattctggacttcagctcactgctgaaa
aagagagacagtttccggaccccgagggactcgaagctggaggcaccagcagaggaggac
gtgtgggagatcctacggcaggcacccccatctgagtacgagcgcatcgccttccagtac
ggcgtcactgacctgcgcggcatgctaaagaggctcaagggcatgaggcgcgatgagaag
aagagcacagcctttcagaagaagctggagccggcctaccaggtgagcaaaggccacaag
atccggctgaccgtggaactggctgaccatgacgctgaggtcaaatggctcaagaatggc
caggagatccagatgagcggcagcaagtacatctttgagtccatcggtgccaagcgtacc
ctgaccatcagccagtgctcattggcggacgacgcagcctaccagtgcgtggtgggtggc
gagaagtgtagcacggagctctttgtgaaagagccccctgtgctcatcacgcgccccttg
gaggaccagctggtgatggtggggcagcgggtggagtttgagtgtgaagtatcggaggag
ggggcgcaagtcaaatggctgaaggacggggtggagctgacccgggaggagaccttcaaa
taccggttcaagaaggacgggcagagacaccacctgatcatcaacgaggccatgctggag
gacgcggggcactatgcactgtgcactagcgggggccaggcgctggctgagctcattgtg
caggaaaagaagctggaggtgtaccagagcatcgcagacctgatggtgggcgcaaaggac
caggcggtgttcaaatgtgaggtctcagatgagaatgttcggggtgtgtggctgaagaat
gggaaggagctggtgcccgacagccgcataaaggtgtcccacatcgggcgggtccacaaa
ctgaccattgacgacgtcacacctgccgacgaggctgactacagctttgtgcccgagggc
ttcgcctgcaacctgtcagccaagctccacttcatggaggtcaagattgacttcgtaccc
aggcaggaacctcccaagatccacctggactgcccaggccgcataccagacaccattgtg
gttgtagctggaaataagctacgtctggacgtccctatctctggggaccctgctcccact
gtgatctggcagaaggctatcacgcaggggaataaggccccagccaggccagccccagat
gccccagaggacacaggtgacagcgatgagtgggtgtttgacaagaagctgctgtgtgag
accgagggccgggtccgcgtggagaccaccaaggaccgcagcatcttcacggtcgagggg
gcagagaaggaagatgagggcgtctacacggtcacagtgaagaaccctgtgggcgaggac
caggtcaacctcacagtcaaggtcatcgacgtgccagacgcacctgcggcccccaagatc
agcaacgtgggagaggactcctgcacagtacagtgggagccgcctgcctacgatggcggg
cagcccatcctgggctacatcctggagcgcaagaagaagaagagctaccggtggatgcgg
ctgaacttcgacctgattcaggagctgagtcatgaagcgcggcgcatgatcgagggcgtg
gtgtacgagatgcgcgtctacgcggtcaacgccatcggcatgtccaggcccagccctgcc
tcccagcccttcatgcctatcggtccccccagcgaacccacccacctggcagtagaggac
gtctctgacaccacggtctccctcaagtggcggcccccagagcgcgtgggagcaggaggc
ctggatggctacagcgtggagtactgcccagagggctgctcagagtgggtggctgccctg
caggggctgacagagcacacatcgatactggtgaaggacctgcccacgggggcccggctg
cttttccgagtgcgggcacacaatatggcagggcctggagcccctgttaccaccacggag
ccggtgacagtgcaggagatcctgcaacggccacggcttcagctgcccaggcacctgcgc
cagaccattcagaagaaggtcggggagcctgtgaaccttctcatccctttccagggcaag
ccccggcctcaggtgacctggaccaaagaggggcagcccctggcaggcgaggaggtgagc
atccgcaacagccccacagacaccatcctgttcatccgggccgctcgccgcgtgcattca
ggcacttaccaggtgacggtgcgcattgagaacatggaggacaaggccacgctggtgctg
caggttgttgacaagccaagtcctccccaggatctccgggtgactgacgcctggggtctt
aatgtggctctggagtggaagccaccccaggatgtcggcaacacggagctctgggggtac
acagtgcagaaagccgacaagaagaccatggagtggttcaccgtcttggagcattaccgc
cgcacccactgcgtggtgccagagctcatcattggcaatggctactacttccgcgtcttc
agccagaatatggttggctttagtgacagagcggccaccaccaaggagcccgtctttatc
cccagaccaggcatcacctatgagccacccaactataaggccctggacttctccgaggcc
ccaagcttcacccagcccctggtgaaccgctcggtcatcgcgggctacactgctatgctc
tgctgtgctgtccggggtagccccaagcccaagatttcctggttcaagaatggcctggac
ctgggagaagacgcccgcttccgcatgttcagcaagcagggagtgttgactctggagatt
agaaagccctgcccctttgacgggggcatctatgtctgcagggccaccaacttacagggc
gaggcacggtgtgagtgccgcctggaggtgcgagtgcctcagtga

DBGET integrated database retrieval system