KEGG   Homo sapiens (human): 4609Help
Entry
4609              CDS       T01001                                 

Gene name
MYC, MRTL, MYCC, bHLHe39, c-Myc
Definition
v-myc avian myelocytomatosis viral oncogene homolog
Orthology
K04377  
Myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Jak-STAT signaling pathway
Thyroid hormone signaling pathway
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Endometrial cancer
Thyroid cancer
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00002  
Acute lymphoblastic leukemia (ALL) (precursor T lymphoblastic leukemia)
H00008  
Burkitt lymphoma
H00010  
Multiple myeloma
H00013  
Small cell lung cancer
H00016  
Oral cancer
H00025  
Penile cancer
H00027  
Ovarian cancer
H00028  
Choriocarcinoma
H00031  
Breast cancer
H00036  
Osteosarcoma
H00041  
Kaposi's sarcoma
H00055  
Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4609 (MYC)
   04012 ErbB signaling pathway
    4609 (MYC)
   04310 Wnt signaling pathway
    4609 (MYC)
   04350 TGF-beta signaling pathway
    4609 (MYC)
   04390 Hippo signaling pathway
    4609 (MYC)
   04630 Jak-STAT signaling pathway
    4609 (MYC)
   04151 PI3K-Akt signaling pathway
    4609 (MYC)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4609 (MYC)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    4609 (MYC)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    4609 (MYC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4609 (MYC)
   05202 Transcriptional misregulation in cancers
    4609 (MYC)
   05206 MicroRNAs in cancer
    4609 (MYC)
   05205 Proteoglycans in cancer
    4609 (MYC)
   05210 Colorectal cancer
    4609 (MYC)
   05216 Thyroid cancer
    4609 (MYC)
   05221 Acute myeloid leukemia
    4609 (MYC)
   05220 Chronic myeloid leukemia
    4609 (MYC)
   05219 Bladder cancer
    4609 (MYC)
   05213 Endometrial cancer
    4609 (MYC)
   05222 Small cell lung cancer
    4609 (MYC)
  Infectious diseases
   05166 HTLV-I infection
    4609 (MYC)
   05161 Hepatitis B
    4609 (MYC)
   05169 Epstein-Barr virus infection
    4609 (MYC)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4609 (MYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.21
AA seq 454 aa AA seqDB search
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system