KEGG   Homo sapiens (human): 4613Help
Entry
4613              CDS       T01001                                 

Gene name
MYCN, MODED, N-myc, NMYC, ODED, bHLHe37
Definition
(RefSeq) MYCN proto-oncogene, bHLH transcription factor
  KO
K09109  
N-myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Network
N00131  
Amplified MYCN to transcriptional activation
N00132  
Amplified MYCN to transcriptional repression
Disease
H00043  
Neuroblastoma
H00510  
Feingold syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4613 (MYCN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4613 (MYCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P04198(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p24.3
AA seq 464 aa AA seqDB search
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgagctgctccacgtccaccatgccgggcatgatctgcaagaacccagacctcgag
tttgactcgctacagccctgcttctacccggacgaagatgacttctacttcggcggcccc
gactcgacccccccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ctgtcgcccagccgtggcttcgcggagcacagctccgagcccccgagctgggtcacggag
atgctgcttgagaacgagctgtggggcagcccggccgaggaggacgcgttcggcctgggg
ggactgggtggcctcacccccaacccggtcatcctccaggactgcatgtggagcggcttc
tccgcccgcgagaagctggagcgcgccgtgagcgagaagctgcagcacggccgcgggccg
ccaaccgccggttccaccgcccagtccccgggagccggcgccgccagccctgcgggtcgc
gggcacggcggggctgcgggagccggccgcgccggggccgccctgcccgccgagctcgcc
cacccggccgccgagtgcgtggatcccgccgtggtcttcccctttcccgtgaacaagcgc
gagccagcgcccgtgcccgcagccccggccagtgccccggcggcgggccctgcggtcgcc
tcgggggcgggtattgccgccccagccggggccccgggggtcgcccctccgcgcccaggc
ggccgccagaccagcggcggcgaccacaaggccctcagtacctccggagaggacaccctg
agcgattcagatgatgaagatgatgaagaggaagatgaagaggaagaaatcgacgtggtc
actgtggagaagcggcgttcctcctccaacaccaaggctgtcaccacattcaccatcact
gtgcgtcccaagaacgcagccctgggtcccgggagggctcagtccagcgagctgatcctc
aaacgatgccttcccatccaccagcagcacaactatgccgccccctctccctacgtggag
agtgaggatgcacccccacagaagaagataaagagcgaggcgtccccacgtccgctcaag
agtgtcatccccccaaaggctaagagcttgagcccccgaaactctgactcggaggacagt
gagcgtcgcagaaaccacaacatcctggagcgccagcgccgcaacgaccttcggtccagc
tttctcacgctcagggaccacgtgccggagttggtaaagaatgagaaggccgccaaggtg
gtcattttgaaaaaggccactgagtatgtccactccctccaggccgaggagcaccagctt
ttgctggaaaaggaaaaattgcaggcaagacagcagcagttgctaaagaaaattgaacac
gctcggacttgctag

DBGET integrated database retrieval system