KEGG   Homo sapiens (human): 4625Help
Entry
4625              CDS       T01001                                 

Gene name
MYH7, CMD1S, CMH1, MPD1, MYHCB, SPMD, SPMM
Definition
myosin, heavy chain 7, cardiac muscle, beta
Orthology
K17751  
myosin heavy chain 6/7
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Tight junction
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Viral myocarditis
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
H00294  
Dilated cardiomyopathy (DCM)
H00594  
Distal muscular dystrophies
H00656  
Scapuloperoneal myopathy (SPM)
H00703  
Myosin storage myopathy (MSM)
H01216  
Left ventricular noncompaction (LVNC)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    4625 (MYH7)
 Cellular Processes
  Cell communication
   04530 Tight junction
    4625 (MYH7)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4625 (MYH7)
   04261 Adrenergic signaling in cardiomyocytes
    4625 (MYH7)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4625 (MYH7)
   05414 Dilated cardiomyopathy (DCM)
    4625 (MYH7)
   05416 Viral myocarditis
    4625 (MYH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q12
AA seq 1935 aa AA seqDB search
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT
AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL
FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE
NT seq 5808 nt NT seq  +upstreamnt  +downstreamnt
atgggagattcggagatggcagtctttggggctgccgccccctacctgcgcaagtcagag
aaggagcggctagaagcgcagaccaggccttttgacctcaagaaggatgtcttcgtgcct
gatgacaaacaggagtttgtcaaggccaagatcgtgtctcgagagggtggcaaagtcact
gccgagaccgagtatggcaagacagtgaccgtgaaggaggaccaggtgatgcagcagaac
ccacccaagttcgacaaaatcgaggacatggccatgctgaccttcctgcatgagcccgcg
gtgctctacaacctcaaggatcgctacggctcctggatgatctacacctactcgggcctc
ttctgtgtcaccgtcaacccttacaagtggctgccggtgtacactcctgaggtggtggct
gcctaccggggcaagaagaggagcgaggccccgccccacatcttctccatctccgacaac
gcctatcagtacatgctgacagacagagaaaaccagtccatcctgatcaccggagaatcc
ggagcagggaagacagtcaacaccaagagggtcatccagtactttgctgttattgcagcc
attggggaccgcagcaagaaggaccagagcccgggcaagggcaccctggaggaccagatc
atccaggccaaccctgctctggaggcctttggcaatgccaagaccgtccggaacgacaac
tcctcccgcttcgggaaattcattcgaattcattttggggcaacaggaaagttggcatct
gcagacatagagacctatcttctggaaaaatccagagttattttccagctgaaagcagag
agagattatcacattttctaccaaatcctgtctaacaaaaagcctgagctgctggacatg
ctgctgatcaccaacaacccctacgattatgcattcatctcccaaggagagaccaccgtg
gcctccattgatgacgctgaggagctcatggccactgataacgcttttgatgtgctgggc
ttcacttcagaggagaaaaactccatgtataagctgacaggcgccatcatgcactttgga
aacatgaagttcaagctgaagcagcgggaggagcaggcggagccagacggcactgaagag
gctgacaagtctgcctacctcatggggctgaactcagccgacctgctcaaggggctgtgc
caccctcgggtgaaagtgggcaatgagtacgtcaccaaggggcagaatgtccagcaggtg
atatatgccactggggcactggccaaggcagtgtatgagaggatgttcaactggatggtg
acgcgcatcaatgccaccctggagaccaagcagccacgccagtacttcataggagtcctg
gacatcgctggcttcgagatcttcgatttcaacagctttgagcagctctgcatcaacttc
accaacgagaagctgcagcagttcttcaaccaccacatgtttgtgctggagcaggaggag
tacaagaaggagggcatcgagtggacattcattgactttggcatggacctgcaggcctgc
attgacctcatcgagaagcccatgggcatcatgtccatcctggaagaggagtgcatgttc
cccaaggccaccgacatgaccttcaaggccaagctgtttgacaaccacctgggcaaatcc
gccaacttccagaagccacgcaatatcaaggggaagcctgaagcccacttctccctgatc
cactatgccggcatcgtggactacaacatcattggctggctgcagaagaacaaggatcct
ctcaatgagactgtcgtgggcttgtatcagaagtcttccctcaagctgctcagcaccctg
tttgccaactatgctggggctgatgcgcctattgagaagggcaaaggcaaggccaagaaa
ggctcgtcctttcagactgtgtcagctctgcacagggaaaatctgaacaagctgatgacc
aacttgcgctccacccatccccactttgtacgttgtatcatccctaatgagacaaagtct
ccaggggtgatggacaaccccctggtcatgcaccagctgcgctgcaatggtgtgctggag
ggcatccgcatctgcaggaaaggcttccccaaccgcatcctctacggggacttccggcag
aggtatcgcatcctgaacccagcggccatccctgagggacagttcattgatagcaggaag
ggggcagagaagctgctcagctccctggacattgatcacaaccagtacaagtttggccac
accaaggtgttcttcaaggccgggctgctggggctgctggaggaaatgagggacgagagg
ctgagccgcatcatcacgcgtatccaggcccagtcccgaggtgtgctcgccagaatggag
tacaaaaagctgctggaacgtagagactccctgctggtaatccagtggaacattcgggcc
ttcatgggggtcaagaattggccctggatgaagctctacttcaagatcaagccgctgctg
aagagtgcagaaagagagaaggagatggcctccatgaaggaggagttcacacgcctcaaa
gaggcgctagagaagtccgaggctcgccgcaaggagctggaggagaagatggtgtccctg
ctgcaggagaagaatgacctgcagctccaagtgcaggcggaacaagacaacctggcagat
gctgaggagcgctgtgatcagctgatcaaaaacaagattcagctggaggccaaggtgaag
gagatgaacgagaggctggaggatgaggaggagatgaatgctgagctcactgccaagaag
cgcaagctggaagatgagtgctcagagctcaaaagggacatcgatgatctggagctgaca
ctggccaaagtggagaaggagaaacacgcaacagagaacaaggtgaaaaacctgacagag
gagatggctgggctggatgagatcattgccaagctgaccaaggagaagaaagctctgcaa
gaggcccaccaacaggctctggatgaccttcaggccgaggaggacaaggtcaacaccctg
actaaggccaaagtcaagctggagcagcaagtggatgatctggaaggatccctggagcaa
gagaagaaggtgcgcatggacctggagcgagcgaagcggaagctggagggcgacctgaag
ctgacccaggagagcatcatggacctggagaatgacaagcagcagctggatgagcggctg
aaaaaaaaagactttgagctgaatgctctcaacgcaaggattgaggatgaacaggccctc
ggcagccagctgcagaagaagctcaaggagcttcaggcacgcatcgaggagctggaggag
gagctggaggccgagcgcaccgccagggctaaggtggagaagctgcgctcagacctgtct
cgggagctggaggagatcagcgagcggctggaagaggccggcggggccacgtccgtgcag
atcgagatgaacaagaagcgcgaggccgagttccagaagatgcggcgggacctggaggag
gccacgctgcagcacgaggccactgccgcggccctgcgcaagaagcacgccgacagcgtg
gccgagctgggcgagcagatcgacaacctgcagcgggtgaagcagaagctggagaaggag
aagagcgagttcaagctggagctggatgacgtcacctccaacatggagcagatcatcaag
gccaaggctaacctggagaagatgtgccggaccttggaagaccagatgaatgagcaccgg
agcaaggcggaggagacccagcgttctgtcaacgacctcaccagccagcgggccaagttg
caaaccgagaatggtgagctgtcccggcagctggatgagaaggaggcactgatctcccag
ctgacccgaggcaagctcacctacacccagcagctggaggacctcaagaggcagctggag
gaggaggttaaggcgaagaacgccctggcccacgcactgcagtcggcccggcatgactgc
gacctgctgcgggagcagtacgaggaggagacggaggccaaggccgagctgcagcgcgtc
ctttccaaggccaactcggaggtggcccagtggaggaccaagtatgagacggacgccatt
cagcggactgaggagctcgaggaggccaagaagaagctggcccagcggctgcaggaagct
gaggaggccgtggaggctgttaatgccaagtgctcctcgctggagaagaccaagcaccgg
ctacagaatgagatcgaggacttgatggtggacgtagagcgctccaatgctgctgctgca
gccctggacaagaagcagaggaacttcgacaagatcctggccgagtggaagcagaagtat
gaggagtcgcagtcggagctggagtcctcgcagaaggaggctcgctccctcagcacagag
ctcttcaaactcaagaacgcctatgaggagtccctggaacatctggagaccttcaagcgg
gagaacaaaaacctgcaggaggagatctccgacttgactgagcagttgggttccagcgga
aagactatccatgagctggagaaggtccgaaagcagctggaggccgagaagatggagctg
cagtcagccctggaggaggccgaggcctccctggagcacgaggagggcaagatcctccgg
gcccagctggagttcaaccagatcaaggcagagatcgagcggaagctggcagagaaggac
gaggagatggaacaggccaagcgcaaccacctgcgggtggtggactcgctgcagacctcc
ctggacgcagagacacgcagccgcaacgaggccctgagggtgaagaagaagatggaagga
gacctcaatgagatggagatccagctcagccacgccaaccgcatggccgccgaggcccag
aagcaagtcaagagcctccagagcttgttgaaggacacccagattcagctggacgatgca
gtccgtgccaacgacgacctgaaggagaacatcgccatcgtggagcggcgcaacaacctg
ctgcaggctgagctggaggagttgcgtgccgtggtggagcagacagagcggtcccggaag
ctggcggagcaggagctgattgagactagtgagcgggtgcagctgctgcattcccagaac
accagcctcatcaaccagaagaagaagatggatgctgacctgtcccagctccagactgaa
gtggaggaggcagtgcaggagtgcaggaatgctgaggagaaggccaagaaggccatcacg
gatgccgccatgatggcagaggagctgaagaaggagcaggacaccagcgcccacctggag
cgcatgaagaagaacatggaacagaccattaaggacctgcagcaccggctggacgaagcc
gagcagatcgccctcaagggcggcaagaagcagctgcagaagctggaagcgcgggtgcgg
gagctggagaatgagctggaggccgagcagaagcgcaacgcagagtcggtgaagggcatg
aggaagagcgagcggcgcatcaaggagctcacctaccagacggaggaggacaggaaaaac
ctgctgcggctgcaggacctggtagacaagctgcagctaaaggtcaaggcctacaagcgc
caggccgaggaggcggaggagcaagccaacaccaacctgtccaagttccgcaaggtgcag
cacgagctggatgaggcagaggagcgggcggacatcgccgagtcccaggtcaacaagctg
cgggccaagagccgtgacattggcacgaagggcttgaatgaggagtag

DBGET integrated database retrieval system