KEGG   Homo sapiens (human): 4628Help
Entry
4628              CDS       T01001                                 

Gene name
MYH10, NMMHC-IIB, NMMHCB
Definition
myosin, heavy chain 10, non-muscle
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4628 (MYH10)
  Cell communication
   04530 Tight junction
    4628 (MYH10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    4628 (MYH10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4628 (MYH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 2007 aa AA seqDB search
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPQESPKPVKHQGELERQLLQANPILESFGN
AKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSG
AGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV
SSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQK
AQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNS
FEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPG
VLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADE
WLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYDSVSGLHEPPVDRIVGLD
QVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGK
LDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER
MIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKK
QQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQT
KVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLES
RVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILL
LEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKT
RQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNA
LKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELR
TKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGL
ETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL
DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQ
EQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLE
EKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARYAE
ERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHE
LEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEE
KKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRK
LQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQE
RDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTL
NAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQ
LEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEA
EEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLE
GASLELSDDDTESKTSDVNETQPPQSE
NT seq 6024 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagagaactggactcgaggatccagagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgattggacagctaaaaagctagtgtggattccatca
gaacgccatggttttgaggcagctagtatcaaagaagaacggggagatgaagttatggtg
gagttggcagagaatggaaagaaagcaatggtcaacaaagatgatattcagaagatgaac
ccacctaagttttccaaggtggaggatatggcagaattgacatgcttgaatgaagcttcc
gttttacataatctgaaggatcgctactattcaggactaatctatacttattctggactc
ttctgtgtagttataaacccttacaagaatcttccaatttactctgagaatattattgaa
atgtacagagggaagaagcgtcatgagatgcctccacacatctatgctatatctgaatct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctttgcacgggtgagtca
ggtgctgggaagacagaaaatacaaagaaagttattcagtaccttgcccatgttgcttct
tcacataaaggaagaaaggaccataatattcctcaggaatcgcctaaaccagtgaaacac
cagggggaacttgaacggcagcttttgcaagcaaatccaattctggaatcatttggaaat
gcgaagactgtgaaaaatgataactcatctcgttttggcaaatttattcggatcaacttt
gatgtaactggctatatcgttggggccaacattgaaacataccttctggaaaagtctcgt
gctgttcgtcaagcaaaagatgaacgtacttttcatatcttttaccagttgttatctgga
gcaggagaacacctaaagtctgatttgcttcttgaaggatttaataactacaggtttctc
tccaatggctatattcctattccgggacagcaagacaaagataatttccaggagaccatg
gaagcaatgcacataatgggcttctcccatgaagagattctgtcaatgcttaaagtagta
tcttcagtgctacagtttggaaatatttctttcaaaaaggagagaaatactgatcaagct
tccatgccagaaaatacagttgcgcagaagctctgccatcttcttgggatgaatgtgatg
gagtttactcgggccatcctgactccccggatcaaggtcggccgagactatgtgcaaaaa
gcccagaccaaagaacaggcagattttgcagtagaagcattggcaaaagctacctatgag
cggctctttcgctggctcgttcatcgcatcaataaagctctggataggaccaaacgtcag
ggagcatctttcattggaatcctggatattgctggatttgaaatttttgagctgaactcc
tttgaacaactttgcatcaactacaccaatgagaagctgcagcagctgttcaaccacacc
atgtttatcctagaacaagaggaataccagcgcgaaggcatcgagtggaacttcatcgat
ttcgggctggatctgcagccatgcatcgacctaatagagagacctgcgaaccctcctggt
gtactggcccttttggatgaagaatgctggttccctaaagccacagataaaacctttgtt
gaaaaactggttcaagagcaaggttcccactccaagtttcagaaacctcgacaattaaaa
gacaaagctgatttttgcattatacattatgcagggaaggtggactataaggcagatgag
tggctgatgaagaatatggaccccctgaatgacaacgtggccacccttttgcaccagtca
tcagacagatttgtggcagagctttggaaagatgagattcagaatattcagagagcttct
ttctatgacagtgtttctggtcttcatgagccaccagtggaccgtatcgtgggtctggat
caagtcactggtatgactgagacagcttttggctccgcatataaaaccaagaagggcatg
tttcgtaccgttgggcaactctacaaagaatctctcaccaagctgatggcaactctccga
aacaccaaccctaactttgttcgttgtatcattccaaatcacgagaagagggctggaaaa
ttggatccacacctagtcctagatcagcttcgctgtaatggtgtcctggaagggatccga
atctgtcgccagggcttccctaaccgaatagttttccaggaattcagacagagatatgag
atcctaactccaaatgctattcctaaaggttttatggatggtaaacaggcctgtgaacga
atgatccgggctttagaattggacccaaacttgtacagaattggacagagcaagatattt
ttcagagctggagttctggcacacttagaggaagaaagagatttaaaaatcaccgatatc
attatcttcttccaggccgtttgcagaggttacctggccagaaaggcctttgccaagaag
cagcagcaactaagtgccttaaaggtcttgcagcggaactgtgccgcgtacctgaaatta
cggcactggcagtggtggcgagtcttcacaaaggtgaagccgcttctacaagtgactcgc
caggaggaagaacttcaggccaaagatgaagagctgttgaaggtgaaggagaagcagacg
aaggtggaaggagagctggaggagatggagcggaagcaccagcagcttttagaagagaag
aatatccttgcagaacaactacaagcagagactgagctctttgctgaagcagaagagatg
agggcaagacttgctgctaaaaagcaggaattagaagagattctacatgacttggagtct
agggttgaagaagaagaagaaagaaaccaaatcctccaaaatgaaaagaaaaaaatgcaa
gcacatattcaggacctggaagaacagctagacgaggaggaaggggctcggcaaaagctg
cagctggaaaaggtgacagcagaggccaagatcaagaagatggaagaggagattctgctt
ctcgaggaccaaaattccaagttcatcaaagaaaagaaactcatggaagatcgcattgct
gagtgttcctctcagctggctgaagaggaagaaaaggcgaaaaacttggccaaaatcagg
aataagcaagaagtgatgatctcagatttagaagaacgcttaaagaaggaagaaaagact
cgtcaggaactggaaaaggccaaaagaaaactcgacggggagacgaccgacctgcaggac
cagatcgcagagctgcaggcgcagattgatgagctcaagctgcagctggccaagaaggag
gaggagctgcagggcgcactggccagaggtgatgatgaaacactccataagaacaatgcc
cttaaagttgtgcgagagctacaagcccaaattgctgaacttcaggaagactttgaatcc
gagaaggcttcacggaacaaggccgaaaagcagaaaagggacttgagtgaggaactggaa
gctctgaaaacagagctggaggacacgctggacaccacggcagcccagcaggaactacgt
acaaaacgtgaacaagaagtggcagagctgaagaaagctcttgaggaggaaactaagaac
catgaagctcaaatccaggacatgagacaaagacacgcaacagccctggaggagctctca
gagcagctggaacaggccaagcggttcaaagcaaatctagagaagaacaagcagggcctg
gagacagataacaaggagctggcgtgtgaggtgaaggtcctgcagcaggtcaaggctgag
tctgagcacaagaggaagaagctcgacgcgcaggtccaggagctccatgccaaggtctct
gaaggcgacaggctcagggtggagctggcggagaaagcaagtaagctgcagaatgagcta
gataatgtctccacccttctggaagaagcagagaagaagggtattaaatttgctaaggat
gcagctagtcttgagtctcaactacaggatacacaggagcttcttcaggaggagacacgc
cagaaactaaacctgagcagtcggatccggcagctggaagaggagaagaacagtcttcag
gagcagcaggaggaggaggaggaggccaggaagaacctggagaagcaagtgctggccctg
cagtcccagttggctgataccaagaagaaagtagatgacgacctgggaacaattgaaagt
ctggaagaagccaagaagaagcttctgaaggacgcggaggccctgagccagcgcctggag
gagaaggcactggcgtatgacaaactggagaagaccaagaaccgcctgcagcaggagctg
gacgacctcacggtggacctggaccaccagcgccaggtcgcctccaacttggagaagaag
cagaagaagtttgaccagctgttagcagaagagaagagcatctctgctcgctatgccgaa
gagcgggaccgggccgaagccgaggccagagagaaagaaaccaaagccctgtcactggcc
cgggccctcgaggaagccctggaggccaaggaggagtttgagaggcagaacaagcagctc
cgagcagacatggaagacctcatgagctccaaagatgatgtgggaaaaaacgttcacgaa
cttgaaaaatccaaacgggccctagagcagcaggtggaggaaatgaggacccagctggag
gagctggaagacgaactccaggccacggaagatgccaagcttcgtctggaggtcaacatg
caggccatgaaggcgcagttcgagagagacctgcaaaccagggatgagcagaatgaagag
aagaagcggctgctgatcaaacaggtgcgggagctcgaggcggagctggaggatgagagg
aaacagcgggcgcttgctgtagcttcaaagaaaaagatggagatagacctgaaggacctc
gaagcccaaatcgaggctgcgaacaaagctcgggatgaggtgattaagcagctccgcaag
ctccaggctcagatgaaggattaccaacgtgaattagaagaagctcgtgcatccagagat
gagatttttgctcaatccaaagagagtgaaaagaaattgaagagtctggaagcagaaatc
cttcaattgcaggaggaacttgcctcatctgagcgagcccgccgacacgccgagcaggag
agagatgagctggcggacgagatcaccaacagcgcctctggcaagtccgcgctgctggat
gagaagcggcgtctggaagctcggatcgcacagctggaggaggagctggaagaggagcag
agcaacatggagctgctcaacgaccgcttccgcaagaccactctacaggtggacacactg
aacgccgagctagcagccgagcgcagcgccgcccagaagagtgacaatgcacgccagcaa
ctggagcggcagaacaaggagctgaaggccaagctgcaggaactcgagggtgctgtcaag
tctaagttcaaggccaccatctcagccctggaggccaagattgggcagctggaggagcag
cttgagcaggaagccaaggaacgagcagccgccaacaaattagtccgtcgcactgagaag
aagctgaaagaaatcttcatgcaggttgaggatgagcgtcgacacgcggaccagtataaa
gagcagatggagaaggccaacgctcggatgaagcagcttaaacgccagctggaggaagca
gaagaagaagcgacgcgtgccaacgcatctcggcgtaaactccagcgggaactggatgat
gccaccgaggccaacgagggcctgagccgcgaggtcagcaccctgaagaaccggctgagg
cggggtggccccatcagcttctcttccagccgatctggccggcgccagctgcaccttgaa
ggagcttccctggagctctccgacgatgacacagaaagtaagaccagtgatgtcaacgag
acgcagccaccccagtcagagtaa

DBGET integrated database retrieval system