KEGG   Homo sapiens (human): 4628Help
Entry
4628              CDS       T01001                                 

Gene name
MYH10, NMMHC-IIB, NMMHCB
Definition
(RefSeq) myosin heavy chain 10
  KO
K10352  myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    4628 (MYH10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    4628 (MYH10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    4628 (MYH10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4628 (MYH10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4628 (MYH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ AAA_22
Motif
Other DBs
NCBI-GeneID: 4628
NCBI-ProteinID: NP_005955
OMIM: 160776
HGNC: 7568
Ensembl: ENSG00000133026
Vega: OTTHUMG00000108195
Pharos: P35580(Tbio)
UniProt: P35580
Position
17p13.1
AA seq 1976 aa AA seqDB search
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQR
QVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagagaactggactcgaggatccagagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgattggacagctaaaaagctagtgtggattccatca
gaacgccatggttttgaggcagctagtatcaaagaagaacggggagatgaagttatggtg
gagttggcagagaatggaaagaaagcaatggtcaacaaagatgatattcagaagatgaac
ccacctaagttttccaaggtggaggatatggcagaattgacatgcttgaatgaagcttcc
gttttacataatctgaaggatcgctactattcaggactaatctatacttattctggactc
ttctgtgtagttataaacccttacaagaatcttccaatttactctgagaatattattgaa
atgtacagagggaagaagcgtcatgagatgcctccacacatctatgctatatctgaatct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctttgcacgggtgagtca
ggtgctgggaagacagaaaatacaaagaaagttattcagtaccttgcccatgttgcttct
tcacataaaggaagaaaggaccataatattcctggggaacttgaacggcagcttttgcaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgttttggcaaatttattcggatcaactttgatgtaactggctatatcgttggggccaac
attgaaacataccttctggaaaagtctcgtgctgttcgtcaagcaaaagatgaacgtact
tttcatatcttttaccagttgttatctggagcaggagaacacctaaagtctgatttgctt
cttgaaggatttaataactacaggtttctctccaatggctatattcctattccgggacag
caagacaaagataatttccaggagaccatggaagcaatgcacataatgggcttctcccat
gaagagattctgtcaatgcttaaagtagtatcttcagtgctacagtttggaaatatttct
ttcaaaaaggagagaaatactgatcaagcttccatgccagaaaatacagttgcgcagaag
ctctgccatcttcttgggatgaatgtgatggagtttactcgggccatcctgactccccgg
atcaaggtcggccgagactatgtgcaaaaagcccagaccaaagaacaggcagattttgca
gtagaagcattggcaaaagctacctatgagcggctctttcgctggctcgttcatcgcatc
aataaagctctggataggaccaaacgtcagggagcatctttcattggaatcctggatatt
gctggatttgaaatttttgagctgaactcctttgaacaactttgcatcaactacaccaat
gagaagctgcagcagctgttcaaccacaccatgtttatcctagaacaagaggaataccag
cgcgaaggcatcgagtggaacttcatcgatttcgggctggatctgcagccatgcatcgac
ctaatagagagacctgcgaaccctcctggtgtactggcccttttggatgaagaatgctgg
ttccctaaagccacagataaaacctttgttgaaaaactggttcaagagcaaggttcccac
tccaagtttcagaaacctcgacaattaaaagacaaagctgatttttgcattatacattat
gcagggaaggtggactataaggcagatgagtggctgatgaagaatatggaccccctgaat
gacaacgtggccacccttttgcaccagtcatcagacagatttgtggcagagctttggaaa
gatgtggaccgtatcgtgggtctggatcaagtcactggtatgactgagacagcttttggc
tccgcatataaaaccaagaagggcatgtttcgtaccgttgggcaactctacaaagaatct
ctcaccaagctgatggcaactctccgaaacaccaaccctaactttgttcgttgtatcatt
ccaaatcacgagaagagggctggaaaattggatccacacctagtcctagatcagcttcgc
tgtaatggtgtcctggaagggatccgaatctgtcgccagggcttccctaaccgaatagtt
ttccaggaattcagacagagatatgagatcctaactccaaatgctattcctaaaggtttt
atggatggtaaacaggcctgtgaacgaatgatccgggctttagaattggacccaaacttg
tacagaattggacagagcaagatatttttcagagctggagttctggcacacttagaggaa
gaaagagatttaaaaatcaccgatatcattatcttcttccaggccgtttgcagaggttac
ctggccagaaaggcctttgccaagaagcagcagcaactaagtgccttaaaggtcttgcag
cggaactgtgccgcgtacctgaaattacggcactggcagtggtggcgagtcttcacaaag
gtgaagccgcttctacaagtgactcgccaggaggaagaacttcaggccaaagatgaagag
ctgttgaaggtgaaggagaagcagacgaaggtggaaggagagctggaggagatggagcgg
aagcaccagcagcttttagaagagaagaatatccttgcagaacaactacaagcagagact
gagctctttgctgaagcagaagagatgagggcaagacttgctgctaaaaagcaggaatta
gaagagattctacatgacttggagtctagggttgaagaagaagaagaaagaaaccaaatc
ctccaaaatgaaaagaaaaaaatgcaagcacatattcaggacctggaagaacagctagac
gaggaggaaggggctcggcaaaagctgcagctggaaaaggtgacagcagaggccaagatc
aagaagatggaagaggagattctgcttctcgaggaccaaaattccaagttcatcaaagaa
aagaaactcatggaagatcgcattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcgaaaaacttggccaaaatcaggaataagcaagaagtgatgatctcagatttagaa
gaacgcttaaagaaggaagaaaagactcgtcaggaactggaaaaggccaaaagaaaactc
gacggggagacgaccgacctgcaggaccagatcgcagagctgcaggcgcagattgatgag
ctcaagctgcagctggccaagaaggaggaggagctgcagggcgcactggccagaggtgat
gatgaaacactccataagaacaatgcccttaaagttgtgcgagagctacaagcccaaatt
gctgaacttcaggaagactttgaatccgagaaggcttcacggaacaaggccgaaaagcag
aaaagggacttgagtgaggaactggaagctctgaaaacagagctggaggacacgctggac
accacggcagcccagcaggaactacgtacaaaacgtgaacaagaagtggcagagctgaag
aaagctcttgaggaggaaactaagaaccatgaagctcaaatccaggacatgagacaaaga
cacgcaacagccctggaggagctctcagagcagctggaacaggccaagcggttcaaagca
aatctagagaagaacaagcagggcctggagacagataacaaggagctggcgtgtgaggtg
aaggtcctgcagcaggtcaaggctgagtctgagcacaagaggaagaagctcgacgcgcag
gtccaggagctccatgccaaggtctctgaaggcgacaggctcagggtggagctggcggag
aaagcaagtaagctgcagaatgagctagataatgtctccacccttctggaagaagcagag
aagaagggtattaaatttgctaaggatgcagctagtcttgagtctcaactacaggataca
caggagcttcttcaggaggagacacgccagaaactaaacctgagcagtcggatccggcag
ctggaagaggagaagaacagtcttcaggagcagcaggaggaggaggaggaggccaggaag
aacctggagaagcaagtgctggccctgcagtcccagttggctgataccaagaagaaagta
gatgacgacctgggaacaattgaaagtctggaagaagccaagaagaagcttctgaaggac
gcggaggccctgagccagcgcctggaggagaaggcactggcgtatgacaaactggagaag
accaagaaccgcctgcagcaggagctggacgacctcacggtggacctggaccaccagcgc
caggtcgcctccaacttggagaagaagcagaagaagtttgaccagctgttagcagaagag
aagagcatctctgctcgctatgccgaagagcgggaccgggccgaagccgaggccagagag
aaagaaaccaaagccctgtcactggcccgggccctcgaggaagccctggaggccaaggag
gagtttgagaggcagaacaagcagctccgagcagacatggaagacctcatgagctccaaa
gatgatgtgggaaaaaacgttcacgaacttgaaaaatccaaacgggccctagagcagcag
gtggaggaaatgaggacccagctggaggagctggaagacgaactccaggccacggaagat
gccaagcttcgtctggaggtcaacatgcaggccatgaaggcgcagttcgagagagacctg
caaaccagggatgagcagaatgaagagaagaagcggctgctgatcaaacaggtgcgggag
ctcgaggcggagctggaggatgagaggaaacagcgggcgcttgctgtagcttcaaagaaa
aagatggagatagacctgaaggacctcgaagcccaaatcgaggctgcgaacaaagctcgg
gatgaggtgattaagcagctccgcaagctccaggctcagatgaaggattaccaacgtgaa
ttagaagaagctcgtgcatccagagatgagatttttgctcaatccaaagagagtgaaaag
aaattgaagagtctggaagcagaaatccttcaattgcaggaggaacttgcctcatctgag
cgagcccgccgacacgccgagcaggagagagatgagctggcggacgagatcaccaacagc
gcctctggcaagtccgcgctgctggatgagaagcggcgtctggaagctcggatcgcacag
ctggaggaggagctggaagaggagcagagcaacatggagctgctcaacgaccgcttccgc
aagaccactctacaggtggacacactgaacgccgagctagcagccgagcgcagcgccgcc
cagaagagtgacaatgcacgccagcaactggagcggcagaacaaggagctgaaggccaag
ctgcaggaactcgagggtgctgtcaagtctaagttcaaggccaccatctcagccctggag
gccaagattgggcagctggaggagcagcttgagcaggaagccaaggaacgagcagccgcc
aacaaattagtccgtcgcactgagaagaagctgaaagaaatcttcatgcaggttgaggat
gagcgtcgacacgcggaccagtataaagagcagatggagaaggccaacgctcggatgaag
cagcttaaacgccagctggaggaagcagaagaagaagcgacgcgtgccaacgcatctcgg
cgtaaactccagcgggaactggatgatgccaccgaggccaacgagggcctgagccgcgag
gtcagcaccctgaagaaccggctgaggcggggtggccccatcagcttctcttccagccga
tctggccggcgccagctgcaccttgaaggagcttccctggagctctccgacgatgacaca
gaaagtaagaccagtgatgtcaacgagacgcagccaccccagtcagagtaa

DBGET integrated database retrieval system