KEGG   Homo sapiens (human): 4628Help
Entry
4628              CDS       T01001                                 

Gene name
MYH10, NMMHC-IIB, NMMHCB
Definition
(RefSeq) myosin, heavy chain 10, non-muscle
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    4628 (MYH10)
  Cellular commiunity
   04530 Tight junction
    4628 (MYH10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    4628 (MYH10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4628 (MYH10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4628 (MYH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 1976 aa AA seqDB search
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQR
QVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagagaactggactcgaggatccagagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgattggacagctaaaaagctagtgtggattccatca
gaacgccatggttttgaggcagctagtatcaaagaagaacggggagatgaagttatggtg
gagttggcagagaatggaaagaaagcaatggtcaacaaagatgatattcagaagatgaac
ccacctaagttttccaaggtggaggatatggcagaattgacatgcttgaatgaagcttcc
gttttacataatctgaaggatcgctactattcaggactaatctatacttattctggactc
ttctgtgtagttataaacccttacaagaatcttccaatttactctgagaatattattgaa
atgtacagagggaagaagcgtcatgagatgcctccacacatctatgctatatctgaatct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctttgcacgggtgagtca
ggtgctgggaagacagaaaatacaaagaaagttattcagtaccttgcccatgttgcttct
tcacataaaggaagaaaggaccataatattcctggggaacttgaacggcagcttttgcaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgttttggcaaatttattcggatcaactttgatgtaactggctatatcgttggggccaac
attgaaacataccttctggaaaagtctcgtgctgttcgtcaagcaaaagatgaacgtact
tttcatatcttttaccagttgttatctggagcaggagaacacctaaagtctgatttgctt
cttgaaggatttaataactacaggtttctctccaatggctatattcctattccgggacag
caagacaaagataatttccaggagaccatggaagcaatgcacataatgggcttctcccat
gaagagattctgtcaatgcttaaagtagtatcttcagtgctacagtttggaaatatttct
ttcaaaaaggagagaaatactgatcaagcttccatgccagaaaatacagttgcgcagaag
ctctgccatcttcttgggatgaatgtgatggagtttactcgggccatcctgactccccgg
atcaaggtcggccgagactatgtgcaaaaagcccagaccaaagaacaggcagattttgca
gtagaagcattggcaaaagctacctatgagcggctctttcgctggctcgttcatcgcatc
aataaagctctggataggaccaaacgtcagggagcatctttcattggaatcctggatatt
gctggatttgaaatttttgagctgaactcctttgaacaactttgcatcaactacaccaat
gagaagctgcagcagctgttcaaccacaccatgtttatcctagaacaagaggaataccag
cgcgaaggcatcgagtggaacttcatcgatttcgggctggatctgcagccatgcatcgac
ctaatagagagacctgcgaaccctcctggtgtactggcccttttggatgaagaatgctgg
ttccctaaagccacagataaaacctttgttgaaaaactggttcaagagcaaggttcccac
tccaagtttcagaaacctcgacaattaaaagacaaagctgatttttgcattatacattat
gcagggaaggtggactataaggcagatgagtggctgatgaagaatatggaccccctgaat
gacaacgtggccacccttttgcaccagtcatcagacagatttgtggcagagctttggaaa
gatgtggaccgtatcgtgggtctggatcaagtcactggtatgactgagacagcttttggc
tccgcatataaaaccaagaagggcatgtttcgtaccgttgggcaactctacaaagaatct
ctcaccaagctgatggcaactctccgaaacaccaaccctaactttgttcgttgtatcatt
ccaaatcacgagaagagggctggaaaattggatccacacctagtcctagatcagcttcgc
tgtaatggtgtcctggaagggatccgaatctgtcgccagggcttccctaaccgaatagtt
ttccaggaattcagacagagatatgagatcctaactccaaatgctattcctaaaggtttt
atggatggtaaacaggcctgtgaacgaatgatccgggctttagaattggacccaaacttg
tacagaattggacagagcaagatatttttcagagctggagttctggcacacttagaggaa
gaaagagatttaaaaatcaccgatatcattatcttcttccaggccgtttgcagaggttac
ctggccagaaaggcctttgccaagaagcagcagcaactaagtgccttaaaggtcttgcag
cggaactgtgccgcgtacctgaaattacggcactggcagtggtggcgagtcttcacaaag
gtgaagccgcttctacaagtgactcgccaggaggaagaacttcaggccaaagatgaagag
ctgttgaaggtgaaggagaagcagacgaaggtggaaggagagctggaggagatggagcgg
aagcaccagcagcttttagaagagaagaatatccttgcagaacaactacaagcagagact
gagctctttgctgaagcagaagagatgagggcaagacttgctgctaaaaagcaggaatta
gaagagattctacatgacttggagtctagggttgaagaagaagaagaaagaaaccaaatc
ctccaaaatgaaaagaaaaaaatgcaagcacatattcaggacctggaagaacagctagac
gaggaggaaggggctcggcaaaagctgcagctggaaaaggtgacagcagaggccaagatc
aagaagatggaagaggagattctgcttctcgaggaccaaaattccaagttcatcaaagaa
aagaaactcatggaagatcgcattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcgaaaaacttggccaaaatcaggaataagcaagaagtgatgatctcagatttagaa
gaacgcttaaagaaggaagaaaagactcgtcaggaactggaaaaggccaaaagaaaactc
gacggggagacgaccgacctgcaggaccagatcgcagagctgcaggcgcagattgatgag
ctcaagctgcagctggccaagaaggaggaggagctgcagggcgcactggccagaggtgat
gatgaaacactccataagaacaatgcccttaaagttgtgcgagagctacaagcccaaatt
gctgaacttcaggaagactttgaatccgagaaggcttcacggaacaaggccgaaaagcag
aaaagggacttgagtgaggaactggaagctctgaaaacagagctggaggacacgctggac
accacggcagcccagcaggaactacgtacaaaacgtgaacaagaagtggcagagctgaag
aaagctcttgaggaggaaactaagaaccatgaagctcaaatccaggacatgagacaaaga
cacgcaacagccctggaggagctctcagagcagctggaacaggccaagcggttcaaagca
aatctagagaagaacaagcagggcctggagacagataacaaggagctggcgtgtgaggtg
aaggtcctgcagcaggtcaaggctgagtctgagcacaagaggaagaagctcgacgcgcag
gtccaggagctccatgccaaggtctctgaaggcgacaggctcagggtggagctggcggag
aaagcaagtaagctgcagaatgagctagataatgtctccacccttctggaagaagcagag
aagaagggtattaaatttgctaaggatgcagctagtcttgagtctcaactacaggataca
caggagcttcttcaggaggagacacgccagaaactaaacctgagcagtcggatccggcag
ctggaagaggagaagaacagtcttcaggagcagcaggaggaggaggaggaggccaggaag
aacctggagaagcaagtgctggccctgcagtcccagttggctgataccaagaagaaagta
gatgacgacctgggaacaattgaaagtctggaagaagccaagaagaagcttctgaaggac
gcggaggccctgagccagcgcctggaggagaaggcactggcgtatgacaaactggagaag
accaagaaccgcctgcagcaggagctggacgacctcacggtggacctggaccaccagcgc
caggtcgcctccaacttggagaagaagcagaagaagtttgaccagctgttagcagaagag
aagagcatctctgctcgctatgccgaagagcgggaccgggccgaagccgaggccagagag
aaagaaaccaaagccctgtcactggcccgggccctcgaggaagccctggaggccaaggag
gagtttgagaggcagaacaagcagctccgagcagacatggaagacctcatgagctccaaa
gatgatgtgggaaaaaacgttcacgaacttgaaaaatccaaacgggccctagagcagcag
gtggaggaaatgaggacccagctggaggagctggaagacgaactccaggccacggaagat
gccaagcttcgtctggaggtcaacatgcaggccatgaaggcgcagttcgagagagacctg
caaaccagggatgagcagaatgaagagaagaagcggctgctgatcaaacaggtgcgggag
ctcgaggcggagctggaggatgagaggaaacagcgggcgcttgctgtagcttcaaagaaa
aagatggagatagacctgaaggacctcgaagcccaaatcgaggctgcgaacaaagctcgg
gatgaggtgattaagcagctccgcaagctccaggctcagatgaaggattaccaacgtgaa
ttagaagaagctcgtgcatccagagatgagatttttgctcaatccaaagagagtgaaaag
aaattgaagagtctggaagcagaaatccttcaattgcaggaggaacttgcctcatctgag
cgagcccgccgacacgccgagcaggagagagatgagctggcggacgagatcaccaacagc
gcctctggcaagtccgcgctgctggatgagaagcggcgtctggaagctcggatcgcacag
ctggaggaggagctggaagaggagcagagcaacatggagctgctcaacgaccgcttccgc
aagaccactctacaggtggacacactgaacgccgagctagcagccgagcgcagcgccgcc
cagaagagtgacaatgcacgccagcaactggagcggcagaacaaggagctgaaggccaag
ctgcaggaactcgagggtgctgtcaagtctaagttcaaggccaccatctcagccctggag
gccaagattgggcagctggaggagcagcttgagcaggaagccaaggaacgagcagccgcc
aacaaattagtccgtcgcactgagaagaagctgaaagaaatcttcatgcaggttgaggat
gagcgtcgacacgcggaccagtataaagagcagatggagaaggccaacgctcggatgaag
cagcttaaacgccagctggaggaagcagaagaagaagcgacgcgtgccaacgcatctcgg
cgtaaactccagcgggaactggatgatgccaccgaggccaacgagggcctgagccgcgag
gtcagcaccctgaagaaccggctgaggcggggtggccccatcagcttctcttccagccga
tctggccggcgccagctgcaccttgaaggagcttccctggagctctccgacgatgacaca
gaaagtaagaccagtgatgtcaacgagacgcagccaccccagtcagagtaa

DBGET integrated database retrieval system