KEGG   Homo sapiens (human): 4629Help
Entry
4629              CDS       T01001                                 

Gene name
MYH11, AAT4, FAA4, SMHC, SMMHC
Definition
(RefSeq) myosin, heavy chain 11, smooth muscle
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Tight junction
Disease
H00801  
Familial thoracic aortic aneurysm and dissection (TAAD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    4629 (MYH11)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    4629 (MYH11)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4629 (MYH11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4629 (MYH11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.11
AA seq 1972 aa AA seqDB search
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLL
LEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFA
VEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEE
KAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQK
HAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDT
QELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKL
QDFASTVEALEEGKKRFQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEK
KAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVED
ERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNETSFVPSRRSGGRRVIENADGSEEETDTRDADFNGTKASE
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaagggccaactcagtgacgatgagaagttcctctttgtggacaaaaacttc
atcaacagcccagtggcccaggctgactgggccgccaagagactcgtctgggtcccctcg
gagaagcagggcttcgaggcagccagcattaaggaggagaagggggatgaggtggttgtg
gagctggtggagaatggcaagaaggtcacggttgggaaagatgacatccagaagatgaac
ccacccaagttctccaaggtggaggacatggcggagctgacgtgcctcaacgaagcctcc
gtgctacacaacctgagggagcggtacttctcagggctaatatatacgtactctggcctc
ttctgcgtggtggtcaacccctataaacacctgcccatctactcggagaagatcgtcgac
atgtacaagggcaagaagaggcacgagatgccgcctcacatctacgccatcgcagacacg
gcctaccggagcatgcttcaagatcgggaggaccagtccattctatgcacaggcgagtct
ggagccgggaaaaccgaaaacaccaagaaggtcattcagtacctggccgtggtggcctcc
tcccacaagggcaagaaagacacaagtatcacgggagagctggaaaagcagcttctacaa
gcaaacccgattctggaggctttcggcaacgccaaaacagtgaagaacgacaactcctca
cgattcggcaaattcatccgcatcaacttcgacgtcacgggttacatcgtgggagccaac
attgagacctatctgctagaaaaatcacgggcaattcgccaagccagagacgagaggaca
ttccacatcttttactacatgattgctggagccaaggagaagatgagaagtgacttgctt
ttggagggcttcaacaactacaccttcctctccaatggctttgtgcccatcccagcagcc
caggatgatgagatgttccaggaaaccgtggaggccatggcaatcatgggtttcagcgag
gaggagcagctatccatattgaaggtggtatcatcggtcctgcagcttggaaatatcgtc
ttcaagaaggaaagaaacacagaccaggcgtccatgccagataacacagctgctcagaaa
gtttgccacctcatgggaattaatgtgacagatttcaccagatccatcctcactcctcgt
atcaaggttgggcgagatgtggtacagaaagctcagacaaaagaacaggctgactttgct
gtagaggctttggccaaggcaacatatgagcgccttttccgctggatactcacccgcgtg
aacaaagccctggacaagacccatcggcaaggggcttccttcctggggatcctggatata
gctggatttgagatctttgaggtgaactccttcgagcagctgtgcatcaactacaccaac
gagaagctgcagcagctcttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgcgagggcatcgagtggaacttcatcgactttgggctggacctacagccctgcatcgag
ctcatcgagcgaccgaacaaccctccaggtgtgctggccctgctggacgaggaatgctgg
ttccccaaagccacggacaagtctttcgtggagaagctgtgcacggagcagggcagccac
cccaagttccagaagcccaagcagctcaaggacaagactgagttctccatcatccattat
gctgggaaggtggactataatgcgagtgcctggctgaccaagaatatggacccgctgaat
gacaacgtgacttccctgctcaatgcctcctccgacaagtttgtggccgacctgtggaag
gacgtggaccgcatcgtgggcctggaccagatggccaagatgacggagagctcgctgccc
agcgcctccaagaccaagaagggcatgttccgcacagtggggcagctgtacaaggagcag
ctgggcaagctgatgaccacgctacgcaacaccacgcccaacttcgtgcgctgcatcatc
cccaaccacgagaagaggtccggcaagctggatgcgttcctggtgctggagcagctgcgg
tgcaatggggtgctggaaggcattcgcatctgccggcagggcttccccaaccggatcgtc
ttccaggagttccgccaacgctacgagatcctggcggcgaatgccatccccaaaggcttc
atggacgggaagcaggcctgcattctcatgatcaaagccctggaacttgaccccaactta
tacaggatagggcagagcaaaatcttcttccgaactggcgtcctggcccacctagaggag
gagcgagatttgaagatcaccgatgtcatcatggccttccaggcgatgtgtcgtggctac
ttggccagaaaggcttttgccaagaggcagcagcagctgaccgccatgaaggtgattcag
aggaactgcgccgcctacctcaagctgcggaactggcagtggtggaggcttttcaccaaa
gtgaagccactgctgcaggtgacacggcaggaggaggagatgcaggccaaggaggatgaa
ctgcagaagaccaaggagcggcagcagaaggcagagaatgagcttaaggagctggaacag
aagcactcgcagctgaccgaggagaagaacctgctacaggaacagctgcaggcagagaca
gagctgtatgcagaggctgaggagatgcgggtgcggctggcggccaagaagcaggagctg
gaggagatactgcatgagatggaggcccgcctggaggaggaggaagacaggggccagcag
ctacaggctgaaaggaagaagatggcccagcagatgctggaccttgaagaacagctggag
gaggaggaagctgccaggcagaagctgcaacttgagaaggtcacggctgaggccaagatc
aagaaactggaggatgagatcctggtcatggatgatcagaacaataaactatcaaaagaa
cgaaaactccttgaggagaggattagtgacttaacgacaaatcttgcagaagaggaagaa
aaggccaagaatcttaccaagctgaaaaacaagcatgaatctatgatttcagaactggaa
gtgcggctaaagaaggaagagaagagccgacaggagctggagaagctgaaacggaagctg
gagggtgatgccagcgacttccacgagcagatcgctgacctccaggcgcagatcgcagag
ctcaagatgcagctggccaagaaggaggaggagctgcaggcggccctggccaggcttgac
gatgaaatcgctcagaagaacaatgccctgaagaagatccgggagctggagggccacatc
tcagacctccaggaggacctggactcagagcgggccgccaggaacaaggctgaaaagcag
aagcgagacctcggcgaggagctggaggccctaaagacagagctggaagacacactggac
agcacagccactcagcaggagctcagggccaagagggagcaggaggtgacggtgctgaag
aaggccctggatgaagagacgcggtcccatgaggctcaggtccaggagatgaggcagaaa
cacgcacaggcggtggaggagctcacagagcagcttgagcagttcaagagggccaaggcg
aacctagacaagaataagcagacgctggagaaagagaacgcagacctggccggggagctg
cgggtcctgggccaggccaagcaggaggtggaacataagaagaagaagctggaggcgcag
gtgcaggagctgcagtccaagtgcagcgatggggagcgggcccgggcggagctcaatgac
aaagtccacaagctgcagaatgaagttgagagcgtcacagggatgcttaacgaggccgag
gggaaggccattaagctggccaaggacgtggcgtccctcagttcccagctccaggacacc
caggagctgcttcaagaagaaacccggcagaagctcaacgtgtctacgaagctgcgccag
ctggaggaggagcggaacagcctgcaagaccagctggacgaggagatggaggccaagcag
aacctggagcgccacatctccactctcaacatccagctctccgactcgaagaagaagctg
caggactttgccagcaccgtggaagctctggaagaggggaagaagaggttccagaaggag
atcgagaacctcacccagcagtacgaggagaaggcggccgcttatgataaactggaaaag
accaagaacaggcttcagcaggagctggacgacctggttgttgatttggacaaccagcgg
caactcgtgtccaacctggaaaagaagcagaggaaatttgatcagttgttagccgaggag
aaaaacatctcttccaaatacgcggatgagagggacagagctgaggcagaagccagggag
aaggaaaccaaggccctgtccctggctcgggcccttgaagaggccttggaagccaaagag
gaactcgagcggaccaacaaaatgctcaaagccgaaatggaagacctggtcagctccaag
gatgacgtgggcaagaacgtccatgagctggagaagtccaagcgggccctggagacccag
atggaggagatgaagacgcagctggaagagctggaggacgagctgcaagccacggaggac
gccaaactgcggctggaagtcaacatgcaggcgctcaagggccagttcgaaagggatctc
caagcccgggacgagcagaatgaggagaagaggaggcaactgcagagacagcttcacgag
tatgagacggaactggaagacgagcgaaagcaacgtgccctggcagctgcagcaaagaag
aagctggaaggggacctgaaagacctggagcttcaggccgactctgccatcaaggggagg
gaggaagccatcaagcagctacgcaaactgcaggctcagatgaaggactttcaaagagag
ctggaagatgcccgtgcctccagagatgagatctttgccacagccaaagagaatgagaag
aaagccaagagcttggaagcagacctcatgcagctacaagaggacctcgccgccgctgag
agggctcgcaaacaagcggacctcgagaaggaggaactggcagaggagctggccagtagc
ctgtcgggaaggaacgcactccaggacgagaagcgccgcctggaggcccggatcgcccag
ctggaggaggagctggaggaggagcagggcaacatggaggccatgagcgaccgggtccgc
aaagccacacagcaggccgagcagctcagcaacgagctggccacagagcgcagcacggcc
cagaagaatgagagtgcccggcagcagctcgagcggcagaacaaggagctccggagcaag
ctccacgagatggagggggccgtcaagtccaagttcaagtccaccatcgcggcgctggag
gccaagattgcacagctggaggagcaggtcgagcaggaggccagagagaaacaggcggcc
accaagtcgctgaagcagaaagacaagaagctgaaggaaatcttgctgcaggtggaggac
gagcgcaagatggccgagcagtacaaggagcaggcagagaaaggcaatgccagggtcaag
cagctcaagaggcagctggaggaggcagaggaggagtcccagcgcatcaacgccaaccgc
aggaagctgcagcgggagctggatgaggccacggagagcaacgaggccatgggccgcgag
gtgaacgcactcaagagcaagctcaggcgaggaaacgagacctctttcgttccttctaga
aggtctggaggacgtagagttattgaaaatgcagatggttctgaggaggaaacggacact
cgagacgcagacttcaatggaaccaaggccagtgaataa

DBGET integrated database retrieval system