KEGG   Homo sapiens (human): 4633Help
Entry
4633              CDS       T01001                                 

Gene name
MYL2, CMH10, MLC2
Definition
myosin, light chain 2, regulatory, cardiac, slow
Orthology
K10351  
myosin regulatory light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Disease
H00292  
Hypertrophic cardiomyopathy (HCM)
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.11
AA seq 166 aa AA seqDB search
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system