KEGG   Homo sapiens (human): 4635Help
Entry
4635              CDS       T01001                                 

Gene name
MYL4, ALC1, AMLC, GT1
Definition
myosin, light chain 4, alkali; atrial, embryonic
Orthology
K12750  
myosin light chain 4
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4635 (MYL4)
   04261 Adrenergic signaling in cardiomyocytes
    4635 (MYL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.32
AA seq 197 aa AA seqDB search
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAF
SLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL
QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQED
ANGCINYEAFVKHIMSG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaagcctgagcctaagaaggaggcagccaagccagctccagctccagct
ccagcccctgcaccagcccctgccccagctcctgaggctcccaaggaacctgcctttgac
cccaagagtgtaaagatagacttcactgccgaccagattgaagagttcaaagaggccttt
tcattgtttgaccggaccccgactggagagatgaagatcacctacggccagtgcggggat
gtactgcgggccctgggccagaaccctaccaatgccgaggtgctgcgtgtgctgggcaag
cccaagcctgaagagatgaatgtcaagatgctggactttgagacgttcttgcccatcctg
cagcacatttcccgcaacaaggagcagggcacctatgaggacttcgtggagggcctgcgt
gtctttgacaaggagagcaatggcacggtcatgggtgctgagcttcggcacgtccttgcc
accctgggagagaagatgactgaggctgaagtggagcagctgttagctgggcaagaggat
gccaatggctgcatcaattatgaagcctttgtcaagcacatcatgtcagggtga

DBGET integrated database retrieval system