KEGG   Homo sapiens (human): 4635Help
Entry
4635              CDS       T01001                                 

Gene name
MYL4, ALC1, AMLC, GT1, PRO1957
Definition
(RefSeq) myosin light chain 4
  KO
K12750  myosin light chain 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
Disease
H00731  Atrial fibrillation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    4635 (MYL4)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4635 (MYL4)
   04261 Adrenergic signaling in cardiomyocytes
    4635 (MYL4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4635 (MYL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 4635
NCBI-ProteinID: NP_001002841
OMIM: 160770
HGNC: 7585
Ensembl: ENSG00000198336
Vega: OTTHUMG00000178232
Pharos: P12829(Tbio)
UniProt: P12829
Position
17q21.32
AA seq 197 aa AA seqDB search
MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAF
SLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL
QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQED
ANGCINYEAFVKHIMSG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaagcctgagcctaagaaggaggcagccaagccagctccagctccagct
ccagcccctgcaccagcccctgccccagctcctgaggctcccaaggaacctgcctttgac
cccaagagtgtaaagatagacttcactgccgaccagattgaagagttcaaagaggccttt
tcattgtttgaccggaccccgactggagagatgaagatcacctacggccagtgcggggat
gtactgcgggccctgggccagaaccctaccaatgccgaggtgctgcgtgtgctgggcaag
cccaagcctgaagagatgaatgtcaagatgctggactttgagacgttcttgcccatcctg
cagcacatttcccgcaacaaggagcagggcacctatgaggacttcgtggagggcctgcgt
gtctttgacaaggagagcaatggcacggtcatgggtgctgagcttcggcacgtccttgcc
accctgggagagaagatgactgaggctgaagtggagcagctgttagctgggcaagaggat
gccaatggctgcatcaattatgaagcctttgtcaagcacatcatgtcagggtga

DBGET integrated database retrieval system