KEGG   Homo sapiens (human): 468Help
Entry
468               CDS       T01001                                 

Gene name
ATF4, CREB-2, CREB2, TAXREB67, TXREB
Definition
activating transcription factor 4
Orthology
K04374  
cyclic AMP-dependent transcription factor ATF-4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    468 (ATF4)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    468 (ATF4)
   04668 TNF signaling pathway
    468 (ATF4)
   04022 cGMP - PKG signaling pathway
    468 (ATF4)
   04151 PI3K-Akt signaling pathway
    468 (ATF4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    468 (ATF4)
   04912 GnRH signaling pathway
    468 (ATF4)
   04915 Estrogen signaling pathway
    468 (ATF4)
   04918 Thyroid hormone synthesis
    468 (ATF4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    468 (ATF4)
  Nervous system
   04725 Cholinergic synapse
    468 (ATF4)
   04728 Dopaminergic synapse
    468 (ATF4)
   04720 Long-term potentiation
    468 (ATF4)
   04722 Neurotrophin signaling pathway
    468 (ATF4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    468 (ATF4)
   05215 Prostate cancer
    468 (ATF4)
  Substance dependence
   05030 Cocaine addiction
    468 (ATF4)
   05031 Amphetamine addiction
    468 (ATF4)
   05034 Alcoholism
    468 (ATF4)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    468 (ATF4)
  Infectious diseases
   05166 HTLV-I infection
    468 (ATF4)
   05161 Hepatitis B
    468 (ATF4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    468 (ATF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 351 aa AA seqDB search
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgattacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacagcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgacttggatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttctgaccacgttggatgacacttgt
gatctctttgcccccctagtccaggagactaataagcagcccccccagacggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttctta
caacctcttcccctttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagactacactgcttac
gttgccatgatccctcagtgcataaaggaggaagacaccccttcagataatgatagtggc
atctgtatgagcccagagtcctatctggggtctcctcagcacagcccctctaccaggggc
tctccaaataggagcctcccatctccaggtgttctctgtgggtctgcccgtcccaaacct
tacgatcctcctggagagaagatggtagcagcaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggctcttactggtgagtgcaaagagctggaaaagaagaacgaggctcta
aaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system