KEGG   Homo sapiens (human): 468Help
Entry
468               CDS       T01001                                 

Gene name
ATF4, CREB-2, CREB2, TAXREB67, TXREB
Definition
activating transcription factor 4
Orthology
K04374  
cyclic AMP-dependent transcription factor ATF-4
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Thyroid hormone synthesis
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 351 aa AA seqDB search
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgattacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacagcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgacttggatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttctgaccacgttggatgacacttgt
gatctctttgcccccctagtccaggagactaataagcagcccccccagacggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttctta
caacctcttcccctttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagactacactgcttac
gttgccatgatccctcagtgcataaaggaggaagacaccccttcagataatgatagtggc
atctgtatgagcccagagtcctatctggggtctcctcagcacagcccctctaccaggggc
tctccaaataggagcctcccatctccaggtgttctctgtgggtctgcccgtcccaaacct
tacgatcctcctggagagaagatggtagcagcaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggctcttactggtgagtgcaaagagctggaaaagaagaacgaggctcta
aaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system