KEGG   Homo sapiens (human): 4684Help
Entry
4684              CDS       T01001                                 

Gene name
NCAM1, CD56, MSK39, NCAM
Definition
(RefSeq) neural cell adhesion molecule 1
  KO
K06491  neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05020  Prion diseases
Drug target
Lorvotuzumab mertansine: D09927
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4684 (NCAM1)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    4684 (NCAM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4684 (NCAM1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  NCAM1/2
   4684 (NCAM1)
CD molecules [BR:hsa04090]
 Proteins
  4684 (NCAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
   4684 (NCAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4684 (NCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Izumo-Ig Ig_5 C1-set Adeno_E3_CR1 Herpes_gE Collagen_bind_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 4684
NCBI-ProteinID: NP_851996
OMIM: 116930
HGNC: 7656
Ensembl: ENSG00000149294
Vega: OTTHUMG00000167196
Pharos: P13591(Tbio)
UniProt: P13591
Structure
PDB: 

Jmol
Position
11q23.2
AA seq 858 aa AA seqDB search
MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF
PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI
HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE
KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDS
ENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI
LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA
SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS
TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE
VKTVPNDATQTKENESKA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaactaaggatctcatctggactttgtttttcctgggaactgcagtttctctg
caggtggatattgttcccagccagggggagatcagcgttggagagtccaaattcttctta
tgccaagtggcaggagatgccaaagataaagacatctcctggttctcccccaatggagaa
aagctcaccccaaaccagcagcggatctcagtggtgtggaatgatgattcctcctccacc
ctcaccatctataacgccaacatcgacgacgccggcatttacaagtgtgtggttacaggc
gaggatggcagtgagtcagaggccaccgtcaacgtgaagatctttcagaagctcatgttc
aagaatgcgccaaccccacaggagttccgggagggggaagatgccgtgattgtgtgtgat
gtggtcagctccctcccaccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccgattcatagtcctgtccaacaactacctgcagatccggggcatcaag
aaaacagatgagggcacttatcgctgtgagggcagaatcctggcacggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtgccacctaccatccaggccaggcagaatatt
gtgaatgccaccgccaacctcggccagtccgtcaccctggtgtgcgatgccgaaggcttc
ccagagcccaccatgagctggacaaaggatggggaacagatagagcaagaggaagacgat
gagaagtacatcttcagcgacgatagttcccagctgaccatcaaaaaggtggataagaac
gacgaggctgagtacatctgcattgctgagaacaaggctggcgagcaggatgcgaccatc
cacctcaaagtctttgcaaaacccaaaatcacatatgtagagaaccagactgccatggaa
ttagaggagcaggtcactcttacctgtgaagcctccggagaccccattccctccatcacc
tggaggacttctacccggaacatcagcagcgaagaaaaggcttcgtggactcgaccagag
aagcaagagactctggatgggcacatggtggtgcgtagccatgcccgtgtgtcgtcgctg
accctgaagagcatccagtacactgatgccggagagtacatctgcaccgccagcaacacc
atcggccaggactcccagtccatgtaccttgaagtgcaatatgccccaaagctacagggc
cctgtggctgtgtacacttgggaggggaaccaggtgaacatcacctgcgaggtatttgcc
tatcccagtgccacgatctcatggtttcgggatggccagctgctgccaagctccaattac
agcaatatcaagatctacaacaccccctctgccagctatctggaggtgaccccagactct
gagaatgattttgggaactacaactgtactgcagtgaaccgcattgggcaggagtccttg
gaattcatccttgttcaagcagacaccccctcttcaccatccatcgaccaggtggagcca
tactccagcacagcccaggtgcagtttgatgaaccagaggccacaggtggggtgcccatc
ctcaaatacaaagctgagtggagagcagttggtgaagaagtatggcattccaagtggtat
gatgccaaggaagccagcatggagggcatcgtcaccatcgtgggcctgaagcccgaaaca
acgtacgccgtaaggctggcggcgctcaatggcaaagggctgggtgagatcagcgcggcc
tccgagttcaagacgcagccagtccaaggggaacccagtgcacctaagctcgaagggcag
atgggagaggatggaaactctattaaagtgaacctgatcaagcaggatgacggcggctcc
cccatcagacactatctggtcaggtaccgagcgctctcctccgagtggaaaccagagatc
aggctcccgtctggcagtgaccacgtcatgctgaagtccctggactggaatgctgagtat
gaggtctacgtggtggctgagaaccagcaaggaaaatccaaggcggctcattttgtgttc
aggacctcggcccagcccacagccatcccagccaacggcagccccacctcaggcctgagc
accggggccatcgtgggcatcctcatcgtcatcttcgtcctgctcctggtggttgtggac
atcacctgctacttcctgaacaagtgtggcctgttcatgtgcattgcggtcaacctgtgt
ggaaaagccgggcccggggccaagggcaaggacatggaggagggcaaggccgccttctcg
aaagatgagtccaaggagcccatcgtggaggttcgaacggaggaggagaggaccccaaac
catgatggagggaaacacacagagcccaacgagaccacgccactgacggagcccgagaag
ggccccgtagaagcaaagccagagtgccaggagacagaaacgaagccagcgccagccgaa
gtcaagacggtccccaatgacgccacacagacaaaggagaacgagagcaaagcatga

DBGET integrated database retrieval system