KEGG   Homo sapiens (human): 4684Help
Entry
4684              CDS       T01001                                 

Gene name
NCAM1, CD56, MSK39, NCAM
Definition
neural cell adhesion molecule 1 (EC:2.7.11.1)
Orthology
K06491  
neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Prion diseases
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4684 (NCAM1)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    4684 (NCAM1)
Cellular antigens [BR:hsa04090]
 Proteins
  4684 (NCAM1)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Adhesion molecules of cell surface (General comment) Cell attachment, inflammation, transition
  4684 (NCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.1
AA seq 848 aa AA seqDB search
MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF
PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI
HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV
VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGN
QVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT
AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV
GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQG
EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVM
LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIV
IFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVE
VRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQ
TKENESKA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaactaaggatctcatctggactttgtttttcctgggaactgcagtttctctg
caggtggatattgttcccagccagggggagatcagcgttggagagtccaaattcttctta
tgccaagtggcaggagatgccaaagataaagacatctcctggttctcccccaatggagaa
aagctcaccccaaaccagcagcggatctcagtggtgtggaatgatgattcctcctccacc
ctcaccatctataacgccaacatcgacgacgccggcatttacaagtgtgtggttacaggc
gaggatggcagtgagtcagaggccaccgtcaacgtgaagatctttcagaagctcatgttc
aagaatgcgccaaccccacaggagttccgggagggggaagatgccgtgattgtgtgtgat
gtggtcagctccctcccaccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccgattcatagtcctgtccaacaactacctgcagatccggggcatcaag
aaaacagatgagggcacttatcgctgtgagggcagaatcctggcacggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtgccacctaccatccaggccaggcagaatatt
gtgaatgccaccgccaacctcggccagtccgtcaccctggtgtgcgatgccgaaggcttc
ccagagcccaccatgagctggacaaaggatggggaacagatagagcaagaggaagacgat
gagaagtacatcttcagcgacgatagttcccagctgaccatcaaaaaggtggataagaac
gacgaggctgagtacatctgcattgctgagaacaaggctggcgagcaggatgcgaccatc
cacctcaaagtctttgcaaaacccaaaatcacatatgtagagaaccagactgccatggaa
ttagaggagcaggtcactcttacctgtgaagcctccggagaccccattccctccatcacc
tggaggacttctacccggaacatcagcagcgaagaaaagactctggatgggcacatggtg
gtgcgtagccatgcccgtgtgtcgtcgctgaccctgaagagcatccagtacactgatgcc
ggagagtacatctgcaccgccagcaacaccatcggccaggactcccagtccatgtacctt
gaagtgcaatatgccccaaagctacagggccctgtggctgtgtacacttgggaggggaac
caggtgaacatcacctgcgaggtatttgcctatcccagtgccacgatctcatggtttcgg
gatggccagctgctgccaagctccaattacagcaatatcaagatctacaacaccccctct
gccagctatctggaggtgaccccagactctgagaatgattttgggaactacaactgtact
gcagtgaaccgcattgggcaggagtccttggaattcatccttgttcaagcagacaccccc
tcttcaccatccatcgaccaggtggagccatactccagcacagcccaggtgcagtttgat
gaaccagaggccacaggtggggtgcccatcctcaaatacaaagctgagtggagagcagtt
ggtgaagaagtatggcattccaagtggtatgatgccaaggaagccagcatggagggcatc
gtcaccatcgtgggcctgaagcccgaaacaacgtacgccgtaaggctggcggcgctcaat
ggcaaagggctgggtgagatcagcgcggcctccgagttcaagacgcagccagtccaaggg
gaacccagtgcacctaagctcgaagggcagatgggagaggatggaaactctattaaagtg
aacctgatcaagcaggatgacggcggctcccccatcagacactatctggtcaggtaccga
gcgctctcctccgagtggaaaccagagatcaggctcccgtctggcagtgaccacgtcatg
ctgaagtccctggactggaatgctgagtatgaggtctacgtggtggctgagaaccagcaa
ggaaaatccaaggcggctcattttgtgttcaggacctcggcccagcccacagccatccca
gccaacggcagccccacctcaggcctgagcaccggggccatcgtgggcatcctcatcgtc
atcttcgtcctgctcctggtggttgtggacatcacctgctacttcctgaacaagtgtggc
ctgttcatgtgcattgcggtcaacctgtgtggaaaagccgggcccggggccaagggcaag
gacatggaggagggcaaggccgccttctcgaaagatgagtccaaggagcccatcgtggag
gttcgaacggaggaggagaggaccccaaaccatgatggagggaaacacacagagcccaac
gagaccacgccactgacggagcccgagaagggccccgtagaagcaaagccagagtgccag
gagacagaaacgaagccagcgccagccgaagtcaagacggtccccaatgacgccacacag
acaaaggagaacgagagcaaagcatga

DBGET integrated database retrieval system