KEGG   Homo sapiens (human): 4691Help
Entry
4691              CDS       T01001                                 

Gene name
NCL, C23
Definition
nucleolin
Orthology
K11294  
nucleolin
Organism
hsa  Homo sapiens (human)
Pathway
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    4691 (NCL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 710 aa AA seqDB search
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA
TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA
APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE
DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG
TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL
EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST
WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL
NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI
VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR
GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctcgcgaaggcaggtaaaaatcaaggtgaccccaagaaaatggctcctcct
ccaaaggaggtagaagaagatagtgaagatgaggaaatgtcagaagatgaagaagatgat
agcagtggagaagaggtcgtcatacctcagaagaaaggcaagaaggctgctgcaacctca
gcaaagaaggtggtcgtttccccaacaaaaaaggttgcagttgccacaccagccaagaaa
gcagctgtcactccaggcaaaaaggcagcagcaacacctgccaagaagacagttacacca
gccaaagcagttaccacacctggcaagaagggagccacaccaggcaaagcattggtagca
actcctggtaagaagggtgctgccatcccagccaagggggcaaagaatggcaagaatgcc
aagaaggaagacagtgatgaagaggaggatgatgacagtgaggaggatgaggaggatgac
gaggacgaggatgaggatgaagatgaaattgaaccagcagcgatgaaagcagcagctgct
gcccctgcctcagaggatgaggacgatgaggatgacgaagatgatgaggatgacgatgac
gatgaggaagatgactctgaagaagaagctatggagactacaccagccaaaggaaagaaa
gctgcaaaagttgttcctgtgaaagccaagaacgtggctgaggatgaagatgaagaagag
gatgatgaggacgaggatgacgacgacgacgaagatgatgaagatgatgatgatgaagat
gatgaggaggaggaagaagaggaggaggaagagcctgtcaaagaagcacctggaaaacga
aagaaggaaatggccaaacagaaagcagctcctgaagccaagaaacagaaagtggaaggc
acagaaccgactacggctttcaatctctttgttggaaacctaaactttaacaaatctgct
cctgaattaaaaactggtatcagcgatgtttttgctaaaaatgatcttgctgttgtggat
gtcagaattggtatgactaggaaatttggttatgtggattttgaatctgctgaagacctg
gagaaagcgttggaactcactggtttgaaagtctttggcaatgaaattaaactagagaaa
ccaaaaggaaaagacagtaagaaagagcgagatgcgagaacacttttggctaaaaatctc
ccttacaaagtcactcaggatgaattgaaagaagtgtttgaagatgctgcggagatcaga
ttagtcagcaaggatgggaaaagtaaagggattgcttatattgaatttaagacagaagct
gatgcagagaaaacctttgaagaaaagcagggaacagagatcgatgggcgatctatttcc
ctgtactatactggagagaaaggtcaaaatcaagactatagaggtggaaagaatagcact
tggagtggtgaatcaaaaactctggttttaagcaacctctcctacagtgcaacagaagaa
actcttcaggaagtatttgagaaagcaacttttatcaaagtaccccagaaccaaaatggc
aaatctaaagggtatgcatttatagagtttgcttcattcgaagacgctaaagaagcttta
aattcctgtaataaaagggaaattgagggcagagcaatcaggctggagttgcaaggaccc
aggggatcacctaatgccagaagccagccatccaaaactctgtttgtcaaaggcctgtct
gaggataccactgaagagacattaaaggagtcatttgacggctccgttcgggcaaggata
gttactgaccgggaaactgggtcctccaaagggtttggttttgtagacttcaacagtgag
gaggatgccaaagctgccaaggaggccatggaagacggtgaaattgatggaaataaagtt
accttggactgggccaaacctaagggtgaaggtggcttcgggggtcgtggtggaggcaga
ggcggctttggaggacgaggtggtggtagaggaggccgaggaggatttggtggcagaggc
cggggaggctttggagggcgaggaggcttccgaggaggcagaggaggaggaggtgaccac
aagccacaaggaaagaagacgaagtttgaatag

DBGET integrated database retrieval system