KEGG   Homo sapiens (human): 4695Help
Entry
4695              CDS       T01001                                 

Gene name
NDUFA2, B8, CD14, CIB8
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4695 (NDUFA2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4695 (NDUFA2)
   05012 Parkinson's disease
    4695 (NDUFA2)
   05016 Huntington's disease
    4695 (NDUFA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4695 (NDUFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 76 aa AA seqDB search
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYASRVQNS
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc
atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc
tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat
gtgcagcccaagctctgggcccgctacgcctccagggtgcagaatagttaa

DBGET integrated database retrieval system