KEGG   Homo sapiens (human): 4696Help
Entry
4696              CDS       T01001                                 

Gene name
NDUFA3, B9, CI-B9
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
Orthology
K03947  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4696 (NDUFA3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4696 (NDUFA3)
   05012 Parkinson's disease
    4696 (NDUFA3)
   05016 Huntington's disease
    4696 (NDUFA3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4696 (NDUFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19q13.42
AA seq 84 aa AA seqDB search
MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD
GNMPDVPSHPQDPQGPSLEWLKKL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagagtcggcgccttcctcaagaatgcctgggacaaggagccagtgctggtc
gtgtccttcgtcgtcgggggcctcgctgtaattctgcccccattgagcccctacttcaag
tactccgtcatgatcaacaaggccacgccctacaactacccagtgcccgtccgtgatgat
gggaacatgcccgacgtgcccagccacccccaggaccctcagggccccagcctggagtgg
ctgaagaaactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system