KEGG   Homo sapiens (human): 4697Help
Entry
4697              CDS       T01001                                 

Gene name
NDUFA4, CI-9k, CI-MLRQ, MLRQ
Definition
(RefSeq) NDUFA4, mitochondrial complex associated
  KO
K03948  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4697 (NDUFA4)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4697 (NDUFA4)
   05012 Parkinson's disease
    4697 (NDUFA4)
   05016 Huntington's disease
    4697 (NDUFA4)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4697 (NDUFA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O00483(Tclin)
UniProt: 
Position
7p21.3
AA seq 81 aa AA seqDB search
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND
QYKFYSVNVDYSKLKKERPDF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctccgccagatcatcggtcaggccaagaagcatccgagcttgatccccctctttgta
tttattggaactggagctactggagcaacactgtatctcttgcgtctggcattgttcaat
ccagatgtttgttgggacagaaataacccagagccctggaacaaactgggtcccaatgat
caatacaagttctactcagtgaatgtggattacagcaagctgaagaaggaacgtccagat
ttctaa

DBGET integrated database retrieval system