KEGG   Homo sapiens (human): 4698Help
Entry
4698              CDS       T01001                                 

Gene name
NDUFA5, B13, CI-13KD-B, CI-13kB, NUFM, UQOR13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A5
  KO
K03949  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4698 (NDUFA5)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4698 (NDUFA5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4698 (NDUFA5)
   05012 Parkinson's disease
    4698 (NDUFA5)
   05016 Huntington's disease
    4698 (NDUFA5)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4698 (NDUFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16718(Tclin)
UniProt: 
Position
7q31.32
AA seq 116 aa AA seqDB search
MPYRVGQTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK
AEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgccttaccgggtagggcagaccactggccttgtgggattggctgtgtgcaatactcct
cacgagaggctaagaatattgtacacaaagattcttgatgttcttgaggaaatccctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgagaagctggctatggttaaa
gcggaaccagatgttaaaaaattagaagaccaacttcaaggcggtcaattagaagaggtg
attcttcaggctgaacatgaactaaatctggcaagaaaaatgagggaatggaaactatgg
gagccattagtggaagagcctcctgccgatcagtggaaatggccaatataa

DBGET integrated database retrieval system