KEGG   Homo sapiens (human): 4704Help
Entry
4704              CDS       T01001                                 

Gene name
NDUFA9, CC6, CI-39k, CI39k, NDUFS2L, SDR22E1
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Orthology
K03953  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4704 (NDUFA9)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4704 (NDUFA9)
   05012 Parkinson's disease
    4704 (NDUFA9)
   05016 Huntington's disease
    4704 (NDUFA9)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4704 (NDUFA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
12p13.3
AA seq 377 aa AA seqDB search
MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV
QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY
LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV
YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW
VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR
WLSAEIEDVKPAKTVNI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccgcacaatcccgggttgtccgggtcctgtcaatgtcacgttctgccatt
actgcaatagccacatctgtgtgtcacggcccaccctgtcgccagcttcatcatgccctc
atgcctcatgggaaaggtggacgttcctcagtcagtgggattgtggccactgtgtttgga
gcaacaggattcctggggcgatatgttgtcaaccaccttggacgcatggggtcacaggta
atcataccctatcggtgtgataaatatgacatcatgcaccttcgtcccatgggtgacctg
ggccagcttctgtttctggaatgggacgcgagagataaagattctatccgacgagtagta
caacacagcaatgtggtcatcaatcttattggacgagactgggaaaccaaaaactttgat
tttgaggatgtttttgtgaagattccccaagcaattgctcaactgtccaaggaagctgga
gttgaaaaattcattcatgtttcacatctgaatgcgaatattaaaagctcttctagatat
ttgagaaataaggctgttggagagaaagtagtgagagatgcatttccggaagccattatc
gtaaagccgtcggacatctttggaagagaggatagattccttaattcttttgcaagtatg
catcggtttggtcctataccccttggttccttgggctggaagacagttaaacaaccagta
tatgtcgtagatgtatccaaaggaattgttaatgcagttaaggatcctgatgccaatggg
aaatcctttgctttcgttggtcccagtcggtacctccttttccacctggtgaagtacatc
tttgctgtggctcacagattgttcctcccattccccttgccgctttttgcctatcgatgg
gtagcaagagtctttgaaataagcccatttgagccctggataacaagggataaagtggag
cggatgcacatcacagacatgaaattgcctcacctgcctggcttagaagaccttggtatt
caggcaacaccactggaactcaaggccattgaggtgctgcggcgtcatcgcacttaccgc
tggctgtctgctgaaattgaggatgtgaagccggccaagaccgtcaacatttag

DBGET integrated database retrieval system