KEGG   Homo sapiens (human): 4706Help
Entry
4706              CDS       T01001                                 

Gene name
NDUFAB1, ACP, FASN2A, SDAP
Definition
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Orthology
K03955  
NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4706 (NDUFAB1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4706 (NDUFAB1)
   05012 Parkinson's disease
    4706 (NDUFAB1)
   05016 Huntington's disease
    4706 (NDUFAB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4706 (NDUFAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.2
AA seq 156 aa AA seqDB search
MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGR
VTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcgtgtcctttcagcctatgtcagccgcctgcccgcggcctttgcgccgctg
ccccgggtccggatgctggccgtggcccggcctctcagcaccgctctctgctccgcgggg
acccagacgaggctcgggactttgcagccggccttagtgctcgcgcaggttcctggtaga
gttacacagttgtgccgccagtatagcgacatgcctcctttgacgttagagggcatccag
gaccgtgttctttacgtattgaaactctatgacaagattgacccagagaagctttcagta
aattctcattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg
gccatggaagacgaatttgggtttgaaattcctgatatagatgctgaaaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtatatgaataa

DBGET integrated database retrieval system