KEGG   Homo sapiens (human): 4723Help
Entry
4723              CDS       T01001                                 

Gene name
NDUFV1, CI-51K, CI51KD, UQOR1
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V1
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:1.6.5.3 1.6.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Disease
H00473  Mitochondrial respiratory chain deficiencies (MRCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4723 (NDUFV1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4723 (NDUFV1)
  Environmental adaptation
   04714 Thermogenesis
    4723 (NDUFV1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4723 (NDUFV1)
   05012 Parkinson's disease
    4723 (NDUFV1)
   05016 Huntington's disease
    4723 (NDUFV1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4723 (NDUFV1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4723 (NDUFV1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     4723 (NDUFV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-GeneID: 4723
NCBI-ProteinID: NP_009034
OMIM: 161015
HGNC: 7716
Ensembl: ENSG00000167792
Vega: OTTHUMG00000166215
Pharos: P49821(Tclin)
UniProt: P49821 E5KNH5
Structure
PDB: 

Jmol
Position
11q13.2
AA seq 464 aa AA seqDB search
MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaacacggcggctgctcggctggtcgcttcccgcgcgggtatctgtgcgtttc
agcggcgacacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg
attttcaccaacctgtacggccgccatgactggaggctgaaaggttccctgagtcgaggt
gactggtacaagacaaaggagatcctgctgaaggggcccgactggatcctgggcgagatc
aagacatcgggtttgaggggccgtggaggcgctggcttccccactggcctcaagtggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaacgcagacgagggg
gagccgggcacctgcaaggaccgggagatcttacgccatgatcctcacaagctgctggaa
ggctgcctggtggggggccgggccatgggcgcccgcgctgcctatatctacatccgaggg
gaattctacaatgaggcctccaatctgcaggtggccatccgagaggcctatgaggcaggt
ctgattggcaagaatgcttgtggctctggctatgattttgacgtgtttgtggtgcgcggg
gctggggcctacatctgtggagaggagacagcgctcatcgagtccattgagggcaagcag
ggcaagccccgcctgaagccccccttccccgcagacgtgggagtgtttggctgccccaca
actgtggccaacgtggagacagtggcagtgtcccccacaatctgccgccgtggaggtacc
tggtttgctggctttggcagagaacgcaactcaggcaccaaactattcaacatctctggc
catgtcaaccacccttgcactgtggaggaggagatgtctgtgcccttgaaagaactgatt
gagaagcatgctgggggtgtcacgggcggctgggacaacctccttgctgtgatccctggc
ggctcgtctaccccactgatccccaagtctgtgtgtgagacggtgctgatggacttcgat
gcgctggtgcaggcacagacaggcctgggcacagctgcggtgatcgtcatggaccgctcg
acggacatcgtgaaagccatcgcccgcctcattgagttctataagcacgagagctgtggc
cagtgtaccccatgccgtgagggtgtggactggatgaacaaggtgatggcacgtttcgtg
aggggggatgcccggccggccgagatcgactccctgtgggagatcagcaagcagatagaa
ggccatacgatttgtgctctgggtgacggggccgcctggcctgtgcagggtctgatccgc
cactttcggccggagctcgaggagcggatgcagcggtttgcccagcagcatcaggcccgg
caggctgcctcttag

DBGET integrated database retrieval system