KEGG   Homo sapiens (human): 474382Help
Entry
474382            CDS       T01001                                 

Gene name
H2AFB1, H2A.Bbd
Definition
H2A histone family, member B1
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    474382 (H2AFB1)
  Substance dependence
   05034 Alcoholism
    474382 (H2AFB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474382 (H2AFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 115 aa AA seqDB search
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcccggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

DBGET integrated database retrieval system