KEGG   Homo sapiens (human): 4772Help
Entry
4772              CDS       T01001                                 

Gene name
NFATC1, NF-ATC, NFAT2, NFATc
Definition
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Orthology
K04446  
nuclear factor of activated T-cells, cytoplasmic 1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Oxytocin signaling pathway
Hepatitis B
HTLV-I infection
Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4772 (NFATC1)
   04310 Wnt signaling pathway
    4772 (NFATC1)
   04024 cAMP signaling pathway
    4772 (NFATC1)
   04022 cGMP - PKG signaling pathway
    4772 (NFATC1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    4772 (NFATC1)
   04660 T cell receptor signaling pathway
    4772 (NFATC1)
   04662 B cell receptor signaling pathway
    4772 (NFATC1)
  Endocrine system
   04921 Oxytocin signaling pathway
    4772 (NFATC1)
  Development
   04380 Osteoclast differentiation
    4772 (NFATC1)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4772 (NFATC1)
  Infectious diseases
   05166 HTLV-I infection
    4772 (NFATC1)
   05161 Hepatitis B
    4772 (NFATC1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4772 (NFATC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q23
AA seq 943 aa AA seqDB search
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcaccagctttccagtcccttccaagtttccacttggccctgcggctgcggtc
ttcgggagaggagaaactttggggcccgcgccgcgcgccggcggcaccatgaagtcagcg
gaggaagaacactatggctatgcatcctccaacgtcagccccgccctgccgctccccacg
gcgcactccaccctgccggccccgtgccacaaccttcagacctccacaccgggcatcatc
ccgccggcggatcacccctcggggtacggagcagctttggacggtgggcccgcgggctac
ttcctctcctccggccacaccaggcctgatggggcccctgccctggagagtcctcgcatc
gagataacctcgtgcttgggcctgtaccacaacaataaccagtttttccacgatgtggag
gtggaagacgtcctccctagctccaaacggtccccctccacggccacgctgagtctgccc
agcctggaggcctacagagacccctcgtgcctgagcccggccagcagcctgtcctcccgg
agctgcaactcagaggcctcctcctacgagtccaactactcgtacccgtacgcgtccccc
cagacgtcgccatggcagtctccctgcgtgtctcccaagaccacggaccccgaggagggc
tttccccgcgggctgggggcctgcacactgctgggttccccgcggcactccccctccacc
tcgccccgcgccagcgtcactgaggagagctggctgggtgcccgctcctccagacccgcg
tccccttgcaacaagaggaagtacagcctcaacggccggcagccgccctactcaccccac
cactcgcccacgccgtccccgcacggctccccgcgggtcagcgtgaccgacgactcgtgg
ttgggcaacaccacccagtacaccagctcggccatcgtggccgccatcaacgcgctgacc
accgacagcagcctggacctgggagatggcgtccctgtcaagtcccgcaagaccaccctg
gagcagccgccctcagtggcgctcaaggtggagcccgtcggggaggacctgggcagcccc
ccgcccccggccgacttcgcgcccgaagactactcctctttccagcacatcaggaagggc
ggcttctgcgaccagtacctggcggtgccgcagcacccctaccagtgggcgaagcccaag
cccctgtcccctacgtcctacatgagcccgaccctgcccgccctggactggcagctgccg
tcccactcaggcccgtatgagcttcggattgaggtgcagcccaagtcccaccaccgagcc
cactacgagacggagggcagccggggggccgtgaaggcgtcggccggaggacaccccatc
gtgcagctgcatggctacttggagaatgagccgctgatgctgcagcttttcattgggacg
gcggacgaccgcctgctgcgcccgcacgccttctaccaggtgcaccgcatcacagggaag
accgtgtccaccaccagccacgaggccatcctctccaacaccaaagtcctggagatccca
ctcctgccggagaacagcatgcgagccgtcattgactgtgccggaatcctgaaactcaga
aactccgacattgaacttcggaaaggagagacggacatcgggaggaagaacacacgggta
cggctggtgttccgcgttcacgtcccgcaacccagcggccgcacgctgtccctgcaggtg
gcctccaaccccatcgaatgctcccagcgctcagctcaggagctgcctctggtggagaag
cagagcacggacagctatccggtcgtgggcgggaagaagatggtcctgtctggccacaac
ttcctgcaggactccaaggtcattttcgtggagaaagccccagatggccaccatgtctgg
gagatggaagcgaaaactgaccgggacctgtgcaagccgaattctctggtggttgagatc
ccgccatttcggaatcagaggataaccagccccgttcacgtcagtttctacgtctgcaac
gggaagagaaagcgaagccagtaccagcgtttcacctaccttcccgccaacgttccaatt
ataaaaacagaacccactgatgattatgagcctgctccaacctgtggaccggtgagccag
gggttaagtcctctcccaagaccatactacagccagcagctcgcgatgccacccgacccc
agctcctgcctcgtggccggcttcccgccctgtccgcagagaagcaccctgatgccagcg
gcccctggcgtgagccccaagctccacgacctttctcccgctgcctacaccaagggcgtt
gccagcccgggccactgtcacctcggactcccgcagccggccggagaggcccccgccgtc
caggacgtgcccaggccagtggccacgcaccccggctcgcccgggcagccacccccggcc
ctgctgccacagcaggtgagtgcgcctccaagcagtagctgcccccctggtctcgaacac
tcgctctgccccagcagcccctctcctccactcccgcctgccacccaagagccgacctgc
ctgcagccctgcagcccagcgtgcccgcccgccacgggccgcccgcagcacctgccgtcc
acggtccgcagggacgagtctccgactgccgggccacggctgctgccagaggtgcatgag
gacggtagtcctaatttggcccctattcctgtaacggtcaagcgagagcctgaagagttg
gaccagttgtacctggatgacgtaaatgaaataatacgaaatgacctctccagcacgagc
acccactcctag

DBGET integrated database retrieval system