KEGG   Homo sapiens (human): 4773Help
Entry
4773              CDS       T01001                                 

Gene name
NFATC2, NFAT1, NFATP
Definition
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Orthology
K17332  
nuclear factor of activated T-cells, cytoplasmic 2
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Oxytocin signaling pathway
Hepatitis B
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4773 (NFATC2)
   04370 VEGF signaling pathway
    4773 (NFATC2)
   04022 cGMP - PKG signaling pathway
    4773 (NFATC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    4773 (NFATC2)
   04660 T cell receptor signaling pathway
    4773 (NFATC2)
   04662 B cell receptor signaling pathway
    4773 (NFATC2)
  Endocrine system
   04921 Oxytocin signaling pathway
    4773 (NFATC2)
  Development
   04360 Axon guidance
    4773 (NFATC2)
   04380 Osteoclast differentiation
    4773 (NFATC2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4773 (NFATC2)
   05161 Hepatitis B
    4773 (NFATC2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4773 (NFATC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.2
AA seq 901 aa AA seqDB search
MQREAAFRLGHCHPLRIMGSVDQEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSG
EPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDD
LCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEAL
VALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPP
KMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLV
PAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGH
PVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLE
IPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQ
IWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPA
IKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDA
RYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHP
SPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSY
PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNI
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagaggctgcgttcagactggggcactgccatcccctccgcatcatggggtct
gtggaccaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagccccccggccgattcggagagccggatagggtagggccgcagaagtttctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtggggcccctccgcatgagagacgcgggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcatcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggctccccggctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagcctcgccacggactcgccttgtgggatccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgccgccccatccaaggccggc
ctgcctcgccacatctacccggccgtggagttcctggggccctgcgagcagggcgagagg
agaaactcggctccagaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccg
ctgtccagtcagtcaggctcttacgagctgcggatcgaggtgcagcccaagccacatcac
cgggcccactatgagacagaaggcagccgaggggctgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagctgatgagcggatccttaagccgcacgccttctaccaggtgcaccgaatcacg
gggaaaactgtcaccaccaccagctatgagaagatagtgggcaacaccaaagtcctggag
atacccttggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
cttagaaacgccgacattgagctgcggaaaggcgagacggacattggaagaaagaacacg
cgggtgagactggttttccgagttcacatcccagagtccagtggcagaatcgtctcttta
cagactgcatctaaccccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacagacagctgcctggtctatggcggccagcaaatgatcctcacgggg
cagaactttacatccgagtccaaagttgtgtttactgagaagaccacagatggacagcaa
atttgggagatggaagccacggtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcatatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccatgga
ggcctggggagccagccttactacccccagcacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctatcagcagccggccctcatggccgccccgctgtcccttgcggacgct
caccgctctgtgctggtgcacgccggctcccagggccagagctcagccctgctccacccc
tctccgaccaaccagcaggcctcgcctgtgatccactactcacccaccaaccagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggc
accaccagacctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcctac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattacctgcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgagctgatagacacacaccttagctggatacaaaacata
ttatga

DBGET integrated database retrieval system