KEGG   Homo sapiens (human): 4773Help
Entry
4773              CDS       T01001                                 

Gene name
NFATC2, NFAT1, NFATP
Definition
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Orthology
K17332  
nuclear factor of activated T-cells, cytoplasmic 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Oxytocin signaling pathway
Hepatitis B
HTLV-I infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.2
AA seq 901 aa AA seqDB search
MQREAAFRLGHCHPLRIMGSVDQEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSG
EPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDD
LCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEAL
VALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPP
KMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLV
PAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGH
PVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLE
IPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQ
IWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPA
IKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDA
RYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHP
SPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSY
PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNI
L
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagaggctgcgttcagactggggcactgccatcccctccgcatcatggggtct
gtggaccaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagccccccggccgattcggagagccggatagggtagggccgcagaagtttctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtggggcccctccgcatgagagacgcgggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcatcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggctccccggctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagcctcgccacggactcgccttgtgggatccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgccgccccatccaaggccggc
ctgcctcgccacatctacccggccgtggagttcctggggccctgcgagcagggcgagagg
agaaactcggctccagaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccg
ctgtccagtcagtcaggctcttacgagctgcggatcgaggtgcagcccaagccacatcac
cgggcccactatgagacagaaggcagccgaggggctgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagctgatgagcggatccttaagccgcacgccttctaccaggtgcaccgaatcacg
gggaaaactgtcaccaccaccagctatgagaagatagtgggcaacaccaaagtcctggag
atacccttggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
cttagaaacgccgacattgagctgcggaaaggcgagacggacattggaagaaagaacacg
cgggtgagactggttttccgagttcacatcccagagtccagtggcagaatcgtctcttta
cagactgcatctaaccccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacagacagctgcctggtctatggcggccagcaaatgatcctcacgggg
cagaactttacatccgagtccaaagttgtgtttactgagaagaccacagatggacagcaa
atttgggagatggaagccacggtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcatatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccatgga
ggcctggggagccagccttactacccccagcacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctatcagcagccggccctcatggccgccccgctgtcccttgcggacgct
caccgctctgtgctggtgcacgccggctcccagggccagagctcagccctgctccacccc
tctccgaccaaccagcaggcctcgcctgtgatccactactcacccaccaaccagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggc
accaccagacctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcctac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattacctgcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgagctgatagacacacaccttagctggatacaaaacata
ttatga

DBGET integrated database retrieval system