KEGG   Homo sapiens (human): 4776Help
Entry
4776              CDS       T01001                                 

Gene name
NFATC4, NF-AT3, NF-ATC4, NFAT3
Definition
(RefSeq) nuclear factor of activated T-cells 4
  KO
K17334  
nuclear factor of activated T-cells, cytoplasmic 4
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Cellular senescence
Wnt signaling pathway
Axon guidance
Oxytocin signaling pathway
Hepatitis B
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Network
N00147  
EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  
KSHV K15 to PLCG-calcineurin signaling pathway
N00180  
KSHV K1 to PLCG-calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4776 (NFATC4)
   04022 cGMP - PKG signaling pathway
    4776 (NFATC4)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    4776 (NFATC4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    4776 (NFATC4)
  Development
   04360 Axon guidance
    4776 (NFATC4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4776 (NFATC4)
   05161 Hepatitis B
    4776 (NFATC4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    4776 (NFATC4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4776 (NFATC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14934(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q12
AA seq 902 aa AA seqDB search
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPAV
SFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggccagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcggggggattgggggaagaactggactcagaggatgcc
ccgccatgctgccgtctggccttgggagagccccctccctatggcgctgcacctatcggt
attccccgacctccaccccctcggcctggcatgcattcgccaccgccgcgaccagccccc
tcacctggcacctgggagagccagcccgccaggtcggtgaggctgggaggaccaggaggg
ggtgctgggggtgctgggggtggccgtgttctcgagtgtcccagcatccgcatcacctcc
atctctcccacgccggagccgccagcagcgctggaggacaaccctgatgcctggggggac
ggctctcctagagattaccccccaccagaaggctttgggggctacagagaagcagggggc
cagggtgggggggccttcttcagcccaagccctggcagcagcagcctgtcctcgtggagc
ttcttctccgatgcctctgacgaggcagccctgtatgcagcctgcgacgaggtggagtct
gagctaaatgaggcggcctcccgctttggcctgggctccccgctgccctcgccccgggcc
tcccctcggccatggacccccgaagatccctggagcctgtatggtccaagccccggaggc
cgagggccagaggatagctggctactcctcagtgctcctgggcccaccccagcctccccg
cggcctgcctctccatgtggcaagcggcgctattccagctcgggaaccccatcttcagcc
tccccagctctgtcccgccgtggcagcctgggggaagaggggtctgagccacctccacca
cccccattgcctctggcccgggacccgggctcccctggtccctttgactatgtgggggcc
ccaccagctgagagcatccctcagaagacacggcggacttccagcgagcaggcagtggct
ctgcctcggtctgaggagcctgcctcatgcaatgggaagctgcccttgggagcagaggag
tctgtggctcctccaggaggttcccggaaggaggtggctggcatggactacctggcagtg
ccctccccactcgcttggtccaaggcccggattgggggacacagccctatcttcaggacc
tctgccctacccccactggactggcctctgcccagccaatatgagcagctggagctgagg
atcgaggtacagcctagagcccaccaccgggcccactatgagacagaaggcagccgtgga
gctgtcaaagctgcccctggcggtcaccccgtagtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcatcggcactgcagatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccgtatcacaggcaagatggtggccacggccagctatgaagccgta
gtcagtggcaccaaggtgttggagatgactctgctgcctgagaacaacatggcggccaac
attgactgcgcgggaatcctgaagcttcggaattcagacattgagcttcggaagggtgag
acggacatcgggcgcaaaaacacacgtgtacggctggtgttccgggtacacgtgccccag
ggcggcgggaaggtcgtctcagtacaggcagcatcggtgcccatcgagtgctcccagcgc
tcagcccaggagctgccccaggtggaggcctacagccccagtgcctgctctgtgagagga
ggcgaggaactggtactgactggctccaacttcctgccagactccaaggtggtgttcatt
gagaggggtcctgatgggaagctgcaatgggaggaggaggccacagtgaaccgactgcag
agcaacgaggtgacgctgaccctgactgtccccgagtacagcaacaagagggtttcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaaacgcagtcctacccagagt
ttcaggtttctgcctgtgatctgcaaagaggagcccctaccggactcatctctgcggggt
ttcccttcagcatcggcaaccccctttggcactgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttgcgaaactccttacctatcagaaggc
ttcggctatggcatgccccctctgtacccccagacggggcccccaccatcctacagaccg
ggcctgcggatgttccctgagactaggggtaccacaggttgtgcccaaccacctgcagtt
tccttccttccccgccccttccctagtgacccgtatggagggcggggctcctctttctcc
ctggggctgccattctctccgccagccccctttcggccgcctcctcttcctgcatcccca
ccgcttgaaggccccttcccttcccagagtgatgtgcatcccctacctgctgagggatac
aataaggtagggccaggctatggccctggggagggggctccggagcaggagaaatccagg
ggtggctacagcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaa
gtgagtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcct
cctgcctga

DBGET integrated database retrieval system