KEGG   Homo sapiens (human): 4776Help
Entry
4776              CDS       T01001                                 

Gene name
NFATC4, NF-AT3, NF-ATC4, NFAT3
Definition
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
Orthology
K17334  
nuclear factor of activated T-cells, cytoplasmic 4
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Wnt signaling pathway
Axon guidance
Oxytocin signaling pathway
Hepatitis B
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    4776 (NFATC4)
   04022 cGMP - PKG signaling pathway
    4776 (NFATC4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    4776 (NFATC4)
  Development
   04360 Axon guidance
    4776 (NFATC4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    4776 (NFATC4)
   05161 Hepatitis B
    4776 (NFATC4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4776 (NFATC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 964 aa AA seqDB search
MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAP
AGSMGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAA
PIGIPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIR
ITSISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLS
SWSFFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPS
PGGRGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEP
PPPPPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLG
AEESVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQL
ELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLR
PHAFYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELR
KGETDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACS
VRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKR
VSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSP
PRPPYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQP
PAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPA
EGYNKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEGGCGTGGCECECVQEIA
LHVC
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaccctcccatctctcctacccgccagcctcgccagtatctcccaccgagtc
acgaatctcccatctaactccctctcacacaacccaggcctctccaagcctgactttccc
ggaaactccagtccaggtcttccttcctcctccagcccaggccgggacctgggggctcct
gccggatccatgggggcggccagctgcgaggatgaggagctggaatttaagctggtgttc
ggggaggaaaaggaggcccccccgctgggcgcggggggattgggggaagaactggactca
gaggatgccccgccatgctgccgtctggccttgggagagccccctccctatggcgctgca
cctatcggtattccccgacctccaccccctcggcctggcatgcattcgccaccgccgcga
ccagccccctcacctggcacctgggagagccagcccgccaggtcggtgaggctgggagga
ccaggagggggtgctgggggtgctgggggtggccgtgttctcgagtgtcccagcatccgc
atcacctccatctctcccacgccggagccgccagcagcgctggaggacaaccctgatgcc
tggggggacggctctcctagagattaccccccaccagaaggctttgggggctacagagaa
gcagggggccagggtgggggggccttcttcagcccaagccctggcagcagcagcctgtcc
tcgtggagcttcttctccgatgcctctgacgaggcagccctgtatgcagcctgcgacgag
gtggagtctgagctaaatgaggcggcctcccgctttggcctgggctccccgctgccctcg
ccccgggcctcccctcggccatggacccccgaagatccctggagcctgtatggtccaagc
cccggaggccgagggccagaggatagctggctactcctcagtgctcctgggcccacccca
gcctccccgcggcctgcctctccatgtggcaagcggcgctattccagctcgggaacccca
tcttcagcctccccagctctgtcccgccgtggcagcctgggggaagaggggtctgagcca
cctccaccacccccattgcctctggcccgggacccgggctcccctggtccctttgactat
gtgggggccccaccagctgagagcatccctcagaagacacggcggacttccagcgagcag
gcagtggctctgcctcggtctgaggagcctgcctcatgcaatgggaagctgcccttggga
gcagaggagtctgtggctcctccaggaggttcccggaaggaggtggctggcatggactac
ctggcagtgccctccccactcgcttggtccaaggcccggattgggggacacagccctatc
ttcaggacctctgccctacccccactggactggcctctgcccagccaatatgagcagctg
gagctgaggatcgaggtacagcctagagcccaccaccgggcccactatgagacagaaggc
agccgtggagctgtcaaagctgcccctggcggtcaccccgtagtcaagctcctaggctac
agtgagaagccactgaccctacagatgttcatcggcactgcagatgaaaggaacctgcgg
cctcatgccttctatcaggtgcaccgtatcacaggcaagatggtggccacggccagctat
gaagccgtagtcagtggcaccaaggtgttggagatgactctgctgcctgagaacaacatg
gcggccaacattgactgcgcgggaatcctgaagcttcggaattcagacattgagcttcgg
aagggtgagacggacatcgggcgcaaaaacacacgtgtacggctggtgttccgggtacac
gtgccccagggcggcgggaaggtcgtctcagtacaggcagcatcggtgcccatcgagtgc
tcccagcgctcagcccaggagctgccccaggtggaggcctacagccccagtgcctgctct
gtgagaggaggcgaggaactggtactgactggctccaacttcctgccagactccaaggtg
gtgttcattgagaggggtcctgatgggaagctgcaatgggaggaggaggccacagtgaac
cgactgcagagcaacgaggtgacgctgaccctgactgtccccgagtacagcaacaagagg
gtttcccggccagtccaggtctacttttatgtctccaatgggcggaggaaacgcagtcct
acccagagtttcaggtttctgcctgtgatctgcaaagaggagcccctaccggactcatct
ctgcggggtttcccttcagcatcggcaaccccctttggcactgacatggacttctcacca
cccaggcccccctacccctcctatccccatgaagaccctgcttgcgaaactccttaccta
tcagaaggcttcggctatggcatgccccctctgtacccccagacggggcccccaccatcc
tacagaccgggcctgcggatgttccctgagactaggggtaccacaggttgtgcccaacca
cctgcagtttccttccttccccgccccttccctagtgacccgtatggagggcggggctcc
tctttctccctggggctgccattctctccgccagccccctttcggccgcctcctcttcct
gcatccccaccgcttgaaggccccttcccttcccagagtgatgtgcatcccctacctgct
gagggatacaataaggtagggccaggctatggccctggggagggggctccggagcaggag
aaatccaggggtggctacagcagcggcttccgagacagtgtccctatccagggtatcacg
ctggaggaaggtgggtgtgggactgggggctgtgagtgtgagtgtgtgcaagagattgct
ctgcatgtttgctga

DBGET integrated database retrieval system