KEGG   Homo sapiens (human): 478Help
Entry
478               CDS       T01001                                 

Gene name
ATP1A3, AHC2, DYT12, RDP
Definition
ATPase, Na+/K+ transporting, alpha 3 polypeptide (EC:3.6.3.9)
Orthology
K01539  
sodium/potassium-transporting ATPase subunit alpha [EC:3.6.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Disease
H00831  
Primary dystonia
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.31
AA seq 1024 aa AA seqDB search
MGGWEEERNRRATDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDC
VQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQA
GTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQ
VNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLET
RNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVA
VFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVK
NLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWV
ALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAE
IPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQ
NAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAV
PDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRD
AKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGV
NDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYT
LTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNP
RTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLE
DSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLF
EETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEK
ETYY
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgggaggctgggaggaggagaggaacaggagagccacggacaagaaagatgacaaggac
tcacccaagaagaacaagggcaaggagcgccgggacctggatgacctcaagaaggaggtg
gctatgacagagcacaagatgtcagtggaagaggtctgccggaaatacaacacagactgt
gtgcagggtttgacccacagcaaagcccaggagatcctggcccgggatgggcctaacgca
ctcacgccaccgcctaccaccccagagtgggtcaagttttgccggcagctcttcgggggc
ttctccatcctgctgtggatcggggctatcctctgcttcctggcctacggtatccaggcg
ggcaccgaggacgacccctctggtgacaacctgtacctgggcatcgtgctggcggccgtg
gtgatcatcactggctgcttctcctactaccaggaggccaagagctccaagatcatggag
tccttcaagaacatggtgccccagcaagccctggtgatccgggaaggtgagaagatgcag
gtgaacgctgaggaggtggtggtcggggacctggtggagatcaagggtggagaccgagtg
ccagctgacctgcggatcatctcagcccacggctgcaaggtggacaactcctccctgact
ggcgaatccgagccccagactcgctctcccgactgcactcacgacaaccccttggagact
cggaacatcaccttcttttccaccaactgtgtggaaggcacggctcggggcgtggtggtg
gccacgggcgaccgcactgtcatgggccgtatcgccaccctggcatcagggctggaggtg
ggcaagacgcccatcgccatcgagattgagcacttcatccagctcatcaccggcgtggct
gtcttcctgggtgtctccttcttcatcctctccctcattctcggatacacctggcttgag
gctgtcatcttcctcatcggcatcatcgtggccaatgtcccagagggtctgctggccact
gtcactgtgtgtctgacgctgaccgccaagcgcatggcccggaagaactgcctggtgaag
aacctggaggctgtagaaaccctgggctccacgtccaccatctgctcagataagacaggg
accctcactcagaaccgcatgacagtcgcccacatgtggtttgacaaccagatccacgag
gctgacaccactgaggaccagtcagggacctcatttgacaagagttcgcacacctgggtg
gccctgtctcacatcgctgggctctgcaatcgcgctgtcttcaagggtggtcaggacaac
atccctgtgctcaagagggatgtggctggggatgcgtctgagtctgccctgctcaagtgc
atcgagctgtcctctggctccgtgaagctgatgcgtgaacgcaacaagaaagtggctgag
attcccttcaattccaccaacaaataccagctctccatccatgagaccgaggaccccaac
gacaaccgatacctgctggtgatgaagggtgcccccgagcgcatcctggaccgctgctcc
accatcctgctacagggcaaggagcagcctctggacgaggaaatgaaggaggccttccag
aatgcctaccttgagctcggtggcctgggcgagcgcgtgcttggtttctgccattattac
ctgcccgaggagcagttccccaagggctttgccttcgactgtgatgacgtgaacttcacc
acggacaacctctgctttgtgggcctcatgtccatgatcgacccaccccgggcagccgtc
cctgacgcggtgggcaagtgtcgcagcgcaggcatcaaggtcatcatggtcaccggcgat
caccccatcacggccaaggccattgccaagggtgtgggcatcatctctgagggcaacgag
actgtggaggacatcgccgcccggctcaacattcccgtcagccaggttaacccccgggat
gccaaggcctgcgtgatccacggcaccgacctcaaggacttcacctccgagcaaatcgac
gagatcctgcagaatcacaccgagatcgtcttcgcccgcacatccccccagcagaagctc
atcattgtggagggctgtcagagacagggtgcaattgtggctgtgaccggggatggtgtg
aacgactcccccgctctgaagaaggccgacattggggtggccatgggcatcgctggctct
gacgtctccaagcaggcagctgacatgatcctgctggacgacaactttgcctccatcgtc
acaggggtggaggagggccgcctgatcttcgacaacctaaagaagtccattgcctacacc
ctgaccagcaatatcccggagatcacgcccttcctgctgttcatcatggccaacatcccg
ctgcccctgggcaccatcaccatcctctgcatcgatctgggcactgacatggtccctgcc
atctcactggcgtacgaggctgccgaaagcgacatcatgaagagacagcccaggaacccg
cggacggacaaattggtcaatgagagactcatcagcatggcctacgggcagattggaatg
atccaggctctcggtggcttcttctcttactttgtgatcctggcagaaaatggcttcttg
cccggcaacctggtgggcatccggctgaactgggatgaccgcaccgtcaatgacctggaa
gacagttacgggcagcagtggacatacgagcagaggaaggtggtggagttcacctgccac
acggccttctttgtgagcatcgttgtcgtccagtgggccgatctgatcatctgcaagacc
cggaggaactcggtcttccagcagggcatgaagaacaagatcctgatcttcgggctgttt
gaggagacggccctggctgccttcctgtcctactgccccggcatggacgtggccctgcgc
atgtaccctctcaagcccagctggtggttctgtgccttcccctacagtttcctcatcttc
gtctacgacgaaatccgcaaactcatcctgcgcaggaacccagggggttgggtggagaag
gaaacctactactga

DBGET integrated database retrieval system