KEGG   Homo sapiens (human): 4790Help
Entry
4790              CDS       T01001                                 

Gene name
NFKB1, EBP-1, KBF1, NF-kB1, NF-kappa-B, NF-kappaB, NFKB-p105, NFKB-p50, NFkappaB, p105, p50
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Orthology
K02580  
nuclear factor NF-kappa-B p105 subunit
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Cocaine addiction
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Inflammatory bowel disease (IBD)
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4790 (NFKB1)
   04010 MAPK signaling pathway
    4790 (NFKB1)
   04064 NF-kappa B signaling pathway
    4790 (NFKB1)
   04668 TNF signaling pathway
    4790 (NFKB1)
   04066 HIF-1 signaling pathway
    4790 (NFKB1)
   04024 cAMP signaling pathway
    4790 (NFKB1)
   04151 PI3K-Akt signaling pathway
    4790 (NFKB1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4790 (NFKB1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    4790 (NFKB1)
   04621 NOD-like receptor signaling pathway
    4790 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    4790 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    4790 (NFKB1)
   04660 T cell receptor signaling pathway
    4790 (NFKB1)
   04662 B cell receptor signaling pathway
    4790 (NFKB1)
   04062 Chemokine signaling pathway
    4790 (NFKB1)
  Endocrine system
   04920 Adipocytokine signaling pathway
    4790 (NFKB1)
   04917 Prolactin signaling pathway
    4790 (NFKB1)
  Nervous system
   04722 Neurotrophin signaling pathway
    4790 (NFKB1)
  Development
   04380 Osteoclast differentiation
    4790 (NFKB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4790 (NFKB1)
   05202 Transcriptional misregulation in cancers
    4790 (NFKB1)
   05206 MicroRNAs in cancer
    4790 (NFKB1)
   05203 Viral carcinogenesis
    4790 (NFKB1)
   05212 Pancreatic cancer
    4790 (NFKB1)
   05221 Acute myeloid leukemia
    4790 (NFKB1)
   05220 Chronic myeloid leukemia
    4790 (NFKB1)
   05215 Prostate cancer
    4790 (NFKB1)
   05222 Small cell lung cancer
    4790 (NFKB1)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    4790 (NFKB1)
  Substance dependence
   05030 Cocaine addiction
    4790 (NFKB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4790 (NFKB1)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4790 (NFKB1)
   05132 Salmonella infection
    4790 (NFKB1)
   05131 Shigellosis
    4790 (NFKB1)
   05133 Pertussis
    4790 (NFKB1)
   05134 Legionellosis
    4790 (NFKB1)
   05152 Tuberculosis
    4790 (NFKB1)
   05166 HTLV-I infection
    4790 (NFKB1)
   05162 Measles
    4790 (NFKB1)
   05164 Influenza A
    4790 (NFKB1)
   05161 Hepatitis B
    4790 (NFKB1)
   05160 Hepatitis C
    4790 (NFKB1)
   05168 Herpes simplex infection
    4790 (NFKB1)
   05169 Epstein-Barr virus infection
    4790 (NFKB1)
   05146 Amoebiasis
    4790 (NFKB1)
   05145 Toxoplasmosis
    4790 (NFKB1)
   05140 Leishmaniasis
    4790 (NFKB1)
   05142 Chagas disease (American trypanosomiasis)
    4790 (NFKB1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4790 (NFKB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 968 aa AA seqDB search
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactacctggtgcctctagtgaaaagaacaagaagtct
taccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggcttcgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggcg
tgtataaggggctataatcctggactcttggtgcaccctgaccttgcctatttgcaagca
gaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaagcagct
ctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatctat
gacagtaaagcccccaatgcatccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtgactggaggggaggaaatttatcttctttgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaagaaaatggtggagtctgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
attaatattacaaaaccagcctctgtgtttgtccagcttcggaggaaatctgacttggaa
actagtgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcag
aggaaacgtcagaagctcatgcccaatttttcggatagtttcggcggtggtagtggtgct
ggagctggaggcggaggcatgtttggtagtggcggtggaggagggggcactggaagtaca
ggtccagggtatagcttcccacactatggatttcctacttatggtgggattactttccat
cctggaactactaaatctaatgctgggatgaagcatggaaccatggacactgaatctaaa
aaggaccctgaaggttgtgacaaaagtgatgacaaaaacactgtaaacctctttgggaaa
gttattgaaaccacagagcaagatcaggagcccagcgaggccaccgttgggaatggtgag
gtcactctaacgtatgcaacaggaacaaaagaagagagtgctggagttcaggataacctc
tttctagagaaggctatgcagcttgcaaagaggcatgccaatgcccttttcgactacgcg
gtgacaggagacgtgaagatgctgctggccgtccagcgccatctcactgctgtgcaggat
gagaatggggacagtgtcttacacttagcaatcatccaccttcattctcaacttgtgagg
gatctactagaagtcacatctggtttgatttctgatgacattatcaacatgagaaatgat
ctgtaccagacgcccttgcacttggcagtgatcactaagcaggaagatgtggtggaggat
ttgctgagggctggggccgacctgagccttctggaccgcttgggtaactctgttttgcac
ctagctgccaaagaaggacatgataaagttctcagtatcttactcaagcacaaaaaggca
gcactacttcttgaccaccccaacggggacggtctgaatgccattcatctagccatgatg
agcaatagcctgccatgtttgctgctgctggtggccgctggggctgacgtcaatgctcag
gagcagaagtccgggcgcacagcactgcacctggctgtggagcacgacaacatctcattg
gcaggctgcctgctcctggagggtgatgcccatgtggacagtactacctacgatggaacc
acacccctgcatatagcagctgggagagggtccaccaggctggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactcttgg
gaaaatgcaggagaggatgaaggagttgtgcctggaaccacgcctctagatatggccacc
agctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatctgat
gatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctgtat
aagttactagaaattcctgatccagacaaaaactgggctactctggcgcagaaattaggt
ctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatggac
aactatgaggtctctgggggtacagtcagagagctggtggaggccctgagacaaatgggc
tacaccgaagcaattgaagtgatccaggcagcctccagcccagtgaagaccacctctcag
gcccactcgctgcctctctcgcctgcctccacaaggcagcaaatagacgagctccgagac
agtgacagtgtctgcgacagcggcgtggagacatccttccgcaaactcagctttaccgag
tctctgaccagtggtgcctcactgctaactctcaacaaaatgccccatgattatgggcag
gaaggacctctagaaggcaaaatttag

DBGET integrated database retrieval system