KEGG   Homo sapiens (human): 4791Help
Entry
4791              CDS       T01001                                 

Gene name
NFKB2, CVID10, H2TF1, LYT-10, LYT10, NF-kB2, p105, p52
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Orthology
K04469  
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Legionellosis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 900 aa AA seqDB search
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggagagttgctacaacccaggtctggatggtattattgaatatgatgatttcaaattg
aactcctccattgtggaacccaaggagccagccccagaaacagctgatggcccctacctg
gtgatcgtggaacagcctaagcagagaggcttccgatttcgatatggctgtgaaggcccc
tcccatggaggactgcccggtgcctccagtgagaagggccgaaagacctatcccactgtc
aagatctgtaactacgagggaccagccaagatcgaggtggacctggtaacacacagtgac
ccacctcgtgctcatgcccacagtctggtgggcaagcaatgctcggagctggggatctgc
gccgtttctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctgcat
gtgactaagaagaacatgatggggactatgatacaaaaacttcagaggcagcggctccgc
tctaggccccagggccttacggaggccgagcagcgggagctggagcaagaggccaaagaa
ctgaagaaggtgatggatctgagtatagtgcggctgcgcttctctgccttccttagagcc
agtgatggctccttctccctgcccctgaagccagtcatctcccagcccatccatgacagc
aaatctccgggggcatcaaacctgaagatttctcgaatggacaagacagcaggctctgtg
cggggtggagatgaagtttatctgctttgtgacaaggtgcagaaagatgacattgaggtt
cggttctatgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gtgcataaacagtatgccattgtgttccggacacccccctatcacaagatgaagattgag
cggcctgtaacagtgtttctgcaactgaaacgcaagcgaggaggggacgtgtctgattcc
aaacagttcacctattaccctctggtggaagacaaggaagaggtgcagcggaagcggagg
aaggccttgcccaccttctcccagcccttcgggggtggctcccacatgggtggaggctct
gggggtgcagccgggggctacggaggagctggaggaggtggcagcctcggtttcttcccc
tcctccctggcctacagcccctaccagtccggcgcgggccccatgggctgctacccggga
ggcgggggcggggcgcagatggccgccacggtgcccagcagggactccggggaggaagcc
gcggagccgagcgccccctccaggaccccccagtgcgagccgcaggccccggagatgctg
cagcgagctcgagagtacaacgcgcgcctgttcggcctggcgcagcgcagcgcccgagcc
ctactcgactacggcgtcaccgcggacgcgcgcgcgctgctggcgggacagcgccacctg
ctgacggcgcaggacgagaacggagacacaccactgcacctagccatcatccacgggcag
accagtgtcattgagcagatagtctatgtcatccaccacgcccaggacctcggcgttgtc
aacctcaccaaccacctgcaccagacgcccctgcacctggcggtgatcacggggcagacg
agtgtggtgagctttctgctgcgggtaggtgcagacccagctctgctggatcggcatgga
gactcagccatgcatctggcgctgcgggcaggcgctggtgctcctgagctgctgcgtgca
ctgcttcagagtggagctcctgctgtgccccagctgttgcatatgcctgactttgaggga
ctgtatccagtacacctggcggtccgagcccgaagccctgagtgcctggatctgctggtg
gacagtggggctgaagtggaggccacagagcggcaggggggacgaacagccttgcatcta
gccacagagatggaggagctggggttggtcacccatctggtcaccaagctccgggccaac
gtgaacgctcgcacctttgcgggaaacacacccctgcacctggcagctggactggggtac
ccgaccctcacccgcctccttctgaaggctggtgctgacatccatgctgaaaacgaggag
cccctgtgcccactgccttcaccccctacctctgatagcgactcggactctgaagggcct
gagaaggacacccgaagcagcttccggggccacacgcctcttgacctcacttgcagcacc
aaggtgaagaccttgctgctaaatgctgctcagaacaccatggagccacccctgaccccg
cccagcccagcagggccgggactgtcacttggtgatacagctctgcagaacctggagcag
ctgctagacgggccagaagcccagggcagctgggcagagctggcagagcgtctggggctg
cgcagcctggtagacacgtaccgacagacaacctcacccagtggcagcctcctgcgcagc
tacgagctggctggcggggacctggcaggtctactggaggccctgtctgacatgggccta
gaggagggagtgaggctgctgaggggtccagaaacccgagacaagctgcccagcacagca
gaggtgaaggaagacagtgcgtacgggagccagtcagtggagcaggaggcagagaagctg
ggcccaccccctgagccaccaggagggctctgccacgggcacccccagcctcaggtgcac
tga

DBGET integrated database retrieval system