KEGG   Homo sapiens (human): 4791Help
Entry
4791              CDS       T01001                                 

Gene name
NFKB2, CVID10, H2TF1, LYT-10, LYT10, NF-kB2, p105, p52
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Orthology
K04469  
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Osteoclast differentiation
Legionellosis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4791 (NFKB2)
   04064 NF-kappa B signaling pathway
    4791 (NFKB2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    4791 (NFKB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    4791 (NFKB2)
   05203 Viral carcinogenesis
    4791 (NFKB2)
  Infectious diseases
   05134 Legionellosis
    4791 (NFKB2)
   05166 HTLV-I infection
    4791 (NFKB2)
   05169 Epstein-Barr virus infection
    4791 (NFKB2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4791 (NFKB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24
AA seq 900 aa AA seqDB search
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggagagttgctacaacccaggtctggatggtattattgaatatgatgatttcaaattg
aactcctccattgtggaacccaaggagccagccccagaaacagctgatggcccctacctg
gtgatcgtggaacagcctaagcagagaggcttccgatttcgatatggctgtgaaggcccc
tcccatggaggactgcccggtgcctccagtgagaagggccgaaagacctatcccactgtc
aagatctgtaactacgagggaccagccaagatcgaggtggacctggtaacacacagtgac
ccacctcgtgctcatgcccacagtctggtgggcaagcaatgctcggagctggggatctgc
gccgtttctgtggggcccaaggacatgactgcccaatttaacaacctgggtgtcctgcat
gtgactaagaagaacatgatggggactatgatacaaaaacttcagaggcagcggctccgc
tctaggccccagggccttacggaggccgagcagcgggagctggagcaagaggccaaagaa
ctgaagaaggtgatggatctgagtatagtgcggctgcgcttctctgccttccttagagcc
agtgatggctccttctccctgcccctgaagccagtcatctcccagcccatccatgacagc
aaatctccgggggcatcaaacctgaagatttctcgaatggacaagacagcaggctctgtg
cggggtggagatgaagtttatctgctttgtgacaaggtgcagaaagatgacattgaggtt
cggttctatgaggatgatgagaatggatggcaggcctttggggacttctctcccacagat
gtgcataaacagtatgccattgtgttccggacacccccctatcacaagatgaagattgag
cggcctgtaacagtgtttctgcaactgaaacgcaagcgaggaggggacgtgtctgattcc
aaacagttcacctattaccctctggtggaagacaaggaagaggtgcagcggaagcggagg
aaggccttgcccaccttctcccagcccttcgggggtggctcccacatgggtggaggctct
gggggtgcagccgggggctacggaggagctggaggaggtggcagcctcggtttcttcccc
tcctccctggcctacagcccctaccagtccggcgcgggccccatgggctgctacccggga
ggcgggggcggggcgcagatggccgccacggtgcccagcagggactccggggaggaagcc
gcggagccgagcgccccctccaggaccccccagtgcgagccgcaggccccggagatgctg
cagcgagctcgagagtacaacgcgcgcctgttcggcctggcgcagcgcagcgcccgagcc
ctactcgactacggcgtcaccgcggacgcgcgcgcgctgctggcgggacagcgccacctg
ctgacggcgcaggacgagaacggagacacaccactgcacctagccatcatccacgggcag
accagtgtcattgagcagatagtctatgtcatccaccacgcccaggacctcggcgttgtc
aacctcaccaaccacctgcaccagacgcccctgcacctggcggtgatcacggggcagacg
agtgtggtgagctttctgctgcgggtaggtgcagacccagctctgctggatcggcatgga
gactcagccatgcatctggcgctgcgggcaggcgctggtgctcctgagctgctgcgtgca
ctgcttcagagtggagctcctgctgtgccccagctgttgcatatgcctgactttgaggga
ctgtatccagtacacctggcggtccgagcccgaagccctgagtgcctggatctgctggtg
gacagtggggctgaagtggaggccacagagcggcaggggggacgaacagccttgcatcta
gccacagagatggaggagctggggttggtcacccatctggtcaccaagctccgggccaac
gtgaacgctcgcacctttgcgggaaacacacccctgcacctggcagctggactggggtac
ccgaccctcacccgcctccttctgaaggctggtgctgacatccatgctgaaaacgaggag
cccctgtgcccactgccttcaccccctacctctgatagcgactcggactctgaagggcct
gagaaggacacccgaagcagcttccggggccacacgcctcttgacctcacttgcagcacc
aaggtgaagaccttgctgctaaatgctgctcagaacaccatggagccacccctgaccccg
cccagcccagcagggccgggactgtcacttggtgatacagctctgcagaacctggagcag
ctgctagacgggccagaagcccagggcagctgggcagagctggcagagcgtctggggctg
cgcagcctggtagacacgtaccgacagacaacctcacccagtggcagcctcctgcgcagc
tacgagctggctggcggggacctggcaggtctactggaggccctgtctgacatgggccta
gaggagggagtgaggctgctgaggggtccagaaacccgagacaagctgcccagcacagca
gaggtgaaggaagacagtgcgtacgggagccagtcagtggagcaggaggcagagaagctg
ggcccaccccctgagccaccaggagggctctgccacgggcacccccagcctcaggtgcac
tga

DBGET integrated database retrieval system