KEGG   Homo sapiens (human): 4793Help
Entry
4793              CDS       T01001                                 

Gene name
NFKBIB, IKBB, TRIP9
Definition
(RefSeq) NFKB inhibitor beta
  KO
K02581  
NF-kappa-B inhibitor beta
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Shigellosis
Leishmaniasis
Toxoplasmosis
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    4793 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    4793 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    4793 (NFKBIB)
   04660 T cell receptor signaling pathway
    4793 (NFKBIB)
   04662 B cell receptor signaling pathway
    4793 (NFKBIB)
   04062 Chemokine signaling pathway
    4793 (NFKBIB)
  Endocrine system
   04920 Adipocytokine signaling pathway
    4793 (NFKBIB)
  Nervous system
   04722 Neurotrophin signaling pathway
    4793 (NFKBIB)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    4793 (NFKBIB)
   05162 Measles
    4793 (NFKBIB)
   05164 Influenza A
    4793 (NFKBIB)
   05168 Herpes simplex infection
    4793 (NFKBIB)
   05169 Epstein-Barr virus infection
    4793 (NFKBIB)
   05145 Toxoplasmosis
    4793 (NFKBIB)
   05140 Leishmaniasis
    4793 (NFKBIB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4793 (NFKBIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 356 aa AA seqDB search
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctggggtcgcgtgcttgggaaaagctgccgacgcagatgaatggtgcgacagcggc
ctgggctccctgggtccggacgcagcggcccccggaggacctgggttgggcgcggagttg
ggcccggggctgtcgtgggctcccctcgtcttcggctacgtcactgaggatggggacacg
gcactgcacttggctgtgattcatcagcatgaacccttcctggattttcttctaggcttc
tcggccggcactgagtacatggacctgcagaatgacctaggccagacagccctgcacctg
gcagccatcctgggggagacatccacggtggagaagctgtacgcagcaggcgccgggctg
tgtgtggcggagcgtaggggccacacggcgctgcacctggcctgccgtgtgggggcacac
gcctgtgcccgtgccctgcttcagccccgcccccggcgccccagggaagcccccgacacc
tacctcgctcagggccctgaccgtactcccgacaccaaccatacccctgtcgccttgtac
cccgattccgacttggagaaggaagaagaggagagtgaggaggactggaagctgcagctg
gaggctgaaaactacgagggccacaccccactccacgtggccgttatccacaaagatgtg
gagatggtccggctgctccgagatgctggagctgaccttgacaaaccggagcccacgtgc
ggccggagcccccttcatttggcagtggaggcccaggcagccgatgtgctggagcttctc
ctgagggcaggcgcgaaccctgctgcccgcatgtacggtggccgcaccccactcggcagt
gccatgctccggcccaaccccatcctcgcccgcctcctccgtgcacacggagcccctgag
cccgagggcgaggacgagaaatccggcccctgcagcagcagtagcgacagcgacagcgga
gacgagggcgatgaatacgacgacattgtggttcacagcagccgcagccaaacccggctg
cctcccaccccagcctcaaaacctcttcctgacgacccccgccccgtgtga

DBGET integrated database retrieval system