KEGG   Homo sapiens (human): 4793Help
Entry
4793              CDS       T01001                                 

Gene name
NFKBIB, IKBB, TRIP9
Definition
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta
Orthology
K02581  
NF-kappa-B inhibitor beta
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Adipocytokine signaling pathway
Shigellosis
Leishmaniasis
Toxoplasmosis
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 270 aa AA seqDB search
MDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARAL
LQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYE
GHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGAN
PAARMYGGRTPLGSAMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEY
DDIVVHSSRSQTRLPPTPASKPLPDDPRPV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcagaatgacctaggccagacagccctgcacctggcagccatcctgggggag
acatccacggtggagaagctgtacgcagcaggcgccgggctgtgtgtggcggagcgtagg
ggccacacggcgctgcacctggcctgccgtgtgggggcacacgcctgtgcccgtgccctg
cttcagccccgcccccggcgccccagggaagcccccgacacctacctcgctcagggccct
gaccgtactcccgacaccaaccatacccctgtcgccttgtaccccgattccgacttggag
aaggaagaagaggagagtgaggaggactggaagctgcagctggaggctgaaaactacgag
ggccacaccccactccacgtggccgttatccacaaagatgtggagatggtccggctgctc
cgagatgctggagctgaccttgacaaaccggagcccacgtgcggccggagcccccttcat
ttggcagtggaggcccaggcagccgatgtgctggagcttctcctgagggcaggcgcgaac
cctgctgcccgcatgtacggtggccgcaccccactcggcagtgccatgctccggcccaac
cccatcctcgcccgcctcctccgtgcacacggagcccctgagcccgagggcgaggacgag
aaatccggcccctgcagcagcagtagcgacagcgacagcggagacgagggcgatgaatac
gacgacattgtggttcacagcagccgcagccaaacccggctgcctcccaccccagcctca
aaacctcttcctgacgacccccgccccgtgtga

DBGET integrated database retrieval system