KEGG   Homo sapiens (human): 480Help
Entry
480               CDS       T01001                                 

Gene name
ATP1A4, ATP1A1, ATP1AL2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:3.6.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04911  Insulin secretion
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04964  Proximal tubule bicarbonate reclamation
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa04974  Protein digestion and absorption
hsa04976  Bile secretion
hsa04978  Mineral absorption
Drug target
Acetyldigitoxin: D06881
Acetyldigoxin: D07555
Bepridil (DG00333): D00631 D07520
Bretylium tosilate: D00645
Deslanoside: D01240
Digitoxin: D00297
Digoxin: D00298
G-strophanthin: D00112
Gitoformate: D07147
Lanatoside C: D01972
Metildigoxin (DG00191): D02587 D09847
Proscillaridin: D01379
beta-Acetyldigoxin: D07556
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    480 (ATP1A4)
   04022 cGMP - PKG signaling pathway
    480 (ATP1A4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    480 (ATP1A4)
   04918 Thyroid hormone synthesis
    480 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    480 (ATP1A4)
   04925 Aldosterone synthesis and secretion
    480 (ATP1A4)
  Circulatory system
   04260 Cardiac muscle contraction
    480 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    480 (ATP1A4)
  Digestive system
   04970 Salivary secretion
    480 (ATP1A4)
   04971 Gastric acid secretion
    480 (ATP1A4)
   04972 Pancreatic secretion
    480 (ATP1A4)
   04976 Bile secretion
    480 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    480 (ATP1A4)
   04974 Protein digestion and absorption
    480 (ATP1A4)
   04978 Mineral absorption
    480 (ATP1A4)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    480 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    480 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    480 (ATP1A4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.9  Na+/K+-exchanging ATPase
     480 (ATP1A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   480 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   480 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   480 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   480 (ATP1A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 480
NCBI-ProteinID: NP_653300
OMIM: 607321
HGNC: 14073
Ensembl: ENSG00000132681
Vega: OTTHUMG00000031609
Pharos: Q13733(Tclin)
UniProt: Q13733
Position
1q23.2
AA seq 1029 aa AA seqDB search
MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELS
TKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCF
VAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVI
RGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFT
HENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIASLTSGLAVGQTPIAAEIEHFI
HLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT
KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMRE
KNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE
MKEAFQNAYLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDP
PRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISK
VDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAV
TGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK
SIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR
LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKY
LNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVL
IFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPD
GWVERETYY
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggggctttgggggaagaaagggacagtggctccccatgaccagagtccaagacgaaga
cctaaaaaagggcttatcaagaaaaaaatggtgaagagggaaaaacagaagcgcaatatg
gaggaactgaagaaggaagtggtcatggatgatcacaaattaaccttggaagagctgagc
accaagtactccgtggacctgacaaagggccatagccaccaaagggcaaaggaaatcctg
actcgaggtggacccaatactgttaccccaccccccaccactccagaatgggtcaaattc
tgtaagcaactgttcggaggcttctccctcctactatggactggggccattctctgcttt
gtggcctacagcatccagatatatttcaatgaggagcctaccaaagacaacctctacctg
agcatcgtactgtccgtcgtggtcatcgtcactggctgcttctcctattatcaggaggcc
aagagctccaagatcatggagtcttttaagaacatggtgcctcagcaagctctggtaatt
cgaggaggagagaagatgcaaattaatgtacaagaggtggtgttgggagacctggtggaa
atcaagggtggagaccgagtccctgctgacctccggcttatctctgcacaaggatgtaag
gtggacaactcatccttgactggggagtcagaaccccagagccgctcccctgacttcacc
catgagaaccctctggagacccgaaacatctgcttcttttccaccaactgtgtggaagga
accgcccggggtattgtgattgctacgggagactccacagtgatgggcagaattgcctcc
ctgacgtcaggcctggcggttggccagacacctatcgctgctgagatcgaacacttcatc
catctgatcactgtggtggccgtcttccttggtgtcactttttttgcgctctcacttctc
ttgggctatggttggctggaggctatcatttttctcattggcatcattgtggccaatgtg
cctgaggggctgttggccacagtcactgtgtgcctgaccctcacagccaagcgcatggcg
cggaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacgtccacc
atctgctcagacaagacgggcaccctcacccagaaccgcatgaccgtcgcccacatgtgg
tttgatatgaccgtgtatgaggccgacaccactgaagaacagactggaaaaacatttacc
aagagctctgatacctggtttatgctggcccgaatcgctggcctctgcaaccgggctgac
tttaaggctaatcaggagatcctgcccattgctaagagggccacaacaggtgatgcttcc
gagtcagccctcctcaagttcatcgagcagtcttacagctctgtggcggagatgagagag
aaaaaccccaaggtggcagagattccctttaattctaccaacaagtaccagatgtccatc
caccttcgggaggacagctcccagacccacgtactgatgatgaagggtgctccggagagg
atcttggagttttgttctacctttcttctgaatgggcaggagtactcaatgaacgatgaa
atgaaggaagccttccaaaatgcctacttagaactgggaggtctgggggaacgtgtgcta
ggcttctgcttcttgaatctgcctagcagcttctccaagggattcccatttaatacagat
gaaataaatttccccatggacaacctttgttttgtgggcctcatatccatgattgaccct
ccccgagctgcagtgcctgatgctgtgagcaagtgtcgcagtgcaggaattaaggtgatc
atggtaacaggagatcatcccattacagctaaggccattgccaagggtgtgggcatcatc
tcagaaggcactgagacggcagaggaagtcgctgcccggcttaagatccctatcagcaag
gtcgatgccagtgctgccaaagccattgtggtgcatggtgcagaactgaaggacatacag
tccaagcagcttgatcagatcctccagaaccaccctgagatcgtgtttgctcggacctcc
cctcagcagaagctcatcattgtcgagggatgtcagaggctgggagccgttgtggccgtg
acaggtgacggggtgaacgactcccctgcgctgaagaaggctgacattggcattgccatg
ggcatctctggctctgacgtctctaagcaggcagccgacatgatcctgctggatgacaac
tttgcctccatcgtcacgggggtggaggagggccgcctgatctttgacaacctgaagaaa
tccatcatgtacaccctgaccagcaacatccccgagatcacgcccttcctgatgttcatc
atcctcggtatacccctgcctctgggaaccataaccatcctctgcattgatctcggcact
gacatggtccctgccatctccttggcttatgagtcagctgaaagcgacatcatgaagagg
cttccaaggaacccaaagacggataatctggtgaaccaccgtctcattggcatggcctat
ggacagattgggatgatccaggctctggctggattctttacctactttgtaatcctggct
gagaatggttttaggcctgttgatctgctgggcatccgcctccactgggaagataaatac
ttgaatgacctggaggacagctacggacagcagtggacctatgagcaacgaaaagttgtg
gagttcacatgccaaacggccttttttgtcaccatcgtggttgtgcagtgggcggatctc
atcatctccaagactcgccgcaactcacttttccagcagggcatgagaaacaaagtctta
atatttgggatcctggaggagacactcttggctgcatttctgtcctacactccaggcatg
gacgtggccctgcgaatgtacccactcaagataacctggtggctctgtgccattccctac
agtattctcatcttcgtctatgatgaaatcagaaaactcctcatccgtcagcacccggat
ggctgggtggaaagggagacgtactactaa

DBGET integrated database retrieval system