KEGG   Homo sapiens (human): 480Help
Entry
480               CDS       T01001                                 

Gene name
ATP1A4, ATP1A1, ATP1AL2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 4 (EC:3.6.3.9)
  KO
K01539  
sodium/potassium-transporting ATPase subunit alpha [EC:3.6.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    480 (ATP1A4)
   04022 cGMP - PKG signaling pathway
    480 (ATP1A4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    480 (ATP1A4)
   04918 Thyroid hormone synthesis
    480 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    480 (ATP1A4)
  Circulatory system
   04260 Cardiac muscle contraction
    480 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    480 (ATP1A4)
  Digestive system
   04970 Salivary secretion
    480 (ATP1A4)
   04971 Gastric acid secretion
    480 (ATP1A4)
   04972 Pancreatic secretion
    480 (ATP1A4)
   04976 Bile secretion
    480 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    480 (ATP1A4)
   04974 Protein digestion and absorption
    480 (ATP1A4)
   04978 Mineral absorption
    480 (ATP1A4)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    480 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    480 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    480 (ATP1A4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.9  Na+/K+-exchanging ATPase
     480 (ATP1A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   480 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   480 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   480 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   480 (ATP1A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.2
AA seq 1029 aa AA seqDB search
MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELS
TKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCF
VAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVI
RGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFT
HENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIASLTSGLAVGQTPIAAEIEHFI
HLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT
KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMRE
KNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE
MKEAFQNAYLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDP
PRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISK
VDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAV
TGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK
SIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR
LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKY
LNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVL
IFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPD
GWVERETYY
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggggctttgggggaagaaagggacagtggctccccatgaccagagtccaagacgaaga
cctaaaaaagggcttatcaagaaaaaaatggtgaagagggaaaaacagaagcgcaatatg
gaggaactgaagaaggaagtggtcatggatgatcacaaattaaccttggaagagctgagc
accaagtactccgtggacctgacaaagggccatagccaccaaagggcaaaggaaatcctg
actcgaggtggacccaatactgttaccccaccccccaccactccagaatgggtcaaattc
tgtaagcaactgttcggaggcttctccctcctactatggactggggccattctctgcttt
gtggcctacagcatccagatatatttcaatgaggagcctaccaaagacaacctctacctg
agcatcgtactgtccgtcgtggtcatcgtcactggctgcttctcctattatcaggaggcc
aagagctccaagatcatggagtcttttaagaacatggtgcctcagcaagctctggtaatt
cgaggaggagagaagatgcaaattaatgtacaagaggtggtgttgggagacctggtggaa
atcaagggtggagaccgagtccctgctgacctccggcttatctctgcacaaggatgtaag
gtggacaactcatccttgactggggagtcagaaccccagagccgctcccctgacttcacc
catgagaaccctctggagacccgaaacatctgcttcttttccaccaactgtgtggaagga
accgcccggggtattgtgattgctacgggagactccacagtgatgggcagaattgcctcc
ctgacgtcaggcctggcggttggccagacacctatcgctgctgagatcgaacacttcatc
catctgatcactgtggtggccgtcttccttggtgtcactttttttgcgctctcacttctc
ttgggctatggttggctggaggctatcatttttctcattggcatcattgtggccaatgtg
cctgaggggctgttggccacagtcactgtgtgcctgaccctcacagccaagcgcatggcg
cggaagaactgcctggtgaagaacctggaggcggtggagacgctgggctccacgtccacc
atctgctcagacaagacgggcaccctcacccagaaccgcatgaccgtcgcccacatgtgg
tttgatatgaccgtgtatgaggccgacaccactgaagaacagactggaaaaacatttacc
aagagctctgatacctggtttatgctggcccgaatcgctggcctctgcaaccgggctgac
tttaaggctaatcaggagatcctgcccattgctaagagggccacaacaggtgatgcttcc
gagtcagccctcctcaagttcatcgagcagtcttacagctctgtggcggagatgagagag
aaaaaccccaaggtggcagagattccctttaattctaccaacaagtaccagatgtccatc
caccttcgggaggacagctcccagacccacgtactgatgatgaagggtgctccggagagg
atcttggagttttgttctacctttcttctgaatgggcaggagtactcaatgaacgatgaa
atgaaggaagccttccaaaatgcctacttagaactgggaggtctgggggaacgtgtgcta
ggcttctgcttcttgaatctgcctagcagcttctccaagggattcccatttaatacagat
gaaataaatttccccatggacaacctttgttttgtgggcctcatatccatgattgaccct
ccccgagctgcagtgcctgatgctgtgagcaagtgtcgcagtgcaggaattaaggtgatc
atggtaacaggagatcatcccattacagctaaggccattgccaagggtgtgggcatcatc
tcagaaggcactgagacggcagaggaagtcgctgcccggcttaagatccctatcagcaag
gtcgatgccagtgctgccaaagccattgtggtgcatggtgcagaactgaaggacatacag
tccaagcagcttgatcagatcctccagaaccaccctgagatcgtgtttgctcggacctcc
cctcagcagaagctcatcattgtcgagggatgtcagaggctgggagccgttgtggccgtg
acaggtgacggggtgaacgactcccctgcgctgaagaaggctgacattggcattgccatg
ggcatctctggctctgacgtctctaagcaggcagccgacatgatcctgctggatgacaac
tttgcctccatcgtcacgggggtggaggagggccgcctgatctttgacaacctgaagaaa
tccatcatgtacaccctgaccagcaacatccccgagatcacgcccttcctgatgttcatc
atcctcggtatacccctgcctctgggaaccataaccatcctctgcattgatctcggcact
gacatggtccctgccatctccttggcttatgagtcagctgaaagcgacatcatgaagagg
cttccaaggaacccaaagacggataatctggtgaaccaccgtctcattggcatggcctat
ggacagattgggatgatccaggctctggctggattctttacctactttgtaatcctggct
gagaatggttttaggcctgttgatctgctgggcatccgcctccactgggaagataaatac
ttgaatgacctggaggacagctacggacagcagtggacctatgagcaacgaaaagttgtg
gagttcacatgccaaacggccttttttgtcaccatcgtggttgtgcagtgggcggatctc
atcatctccaagactcgccgcaactcacttttccagcagggcatgagaaacaaagtctta
atatttgggatcctggaggagacactcttggctgcatttctgtcctacactccaggcatg
gacgtggccctgcgaatgtacccactcaagataacctggtggctctgtgccattccctac
agtattctcatcttcgtctatgatgaaatcagaaaactcctcatccgtcagcacccggat
ggctgggtggaaagggagacgtactactaa

DBGET integrated database retrieval system