KEGG   Homo sapiens (human): 480Help
Entry
480               CDS       T01001                                 

Gene name
ATP1A4, ATP1A1, ATP1AL2
Definition
ATPase, Na+/K+ transporting, alpha 4 polypeptide (EC:3.6.3.9)
Orthology
K01539  
sodium/potassium-transporting ATPase subunit alpha [EC:3.6.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:hsa04964]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.2
AA seq 165 aa AA seqDB search
MIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTC
QTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVAL
RMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPDGWVERETYY
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggctctggctggattctttacctactttgtaatcctggctgagaatggtttt
aggcctgttgatctgctgggcatccgcctccactgggaagataaatacttgaatgacctg
gaggacagctacggacagcagtggacctatgagcaacgaaaagttgtggagttcacatgc
caaacggccttttttgtcaccatcgtggttgtgcagtgggcggatctcatcatctccaag
actcgccgcaactcacttttccagcagggcatgagaaacaaagtcttaatatttgggatc
ctggaggagacactcttggctgcatttctgtcctacactccaggcatggacgtggccctg
cgaatgtacccactcaagataacctggtggctctgtgccattccctacagtattctcatc
ttcgtctatgatgaaatcagaaaactcctcatccgtcagcacccggatggctgggtggaa
agggagacgtactactaa

DBGET integrated database retrieval system