KEGG   Homo sapiens (human): 4804Help
Entry
4804              CDS       T01001                                 

Gene name
NGFR, CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Definition
(RefSeq) nerve growth factor receptor
  KO
K02583  
nerve growth factor receptor (TNFR superfamily member 16)
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis - multiple species
Neurotrophin signaling pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    4804 (NGFR)
   04015 Rap1 signaling pathway
    4804 (NGFR)
   04010 MAPK signaling pathway
    4804 (NGFR)
   04151 PI3K-Akt signaling pathway
    4804 (NGFR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4804 (NGFR)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    4804 (NGFR)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    4804 (NGFR)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4804 (NGFR)
Cytokine receptors [BR:hsa04050]
 TNF receptor family
  4804 (NGFR)
CD molecules [BR:hsa04090]
 Proteins
  4804 (NGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P08138(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.33
AA seq 427 aa AA seqDB search
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacacagc
ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcgacc
gagccgtgcaagccgtgcaccgagtgcgtggggctccagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcctgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca
cccccagagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacggtggcaggtgtggtgaccacagtgatgggcagctcccag
cccgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccac
acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacggctctgcgggggacacctggcgg
cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccatgaggcc
tgccccgttcgcgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag
tccactgccacatccccggtgtga

DBGET integrated database retrieval system