KEGG   Homo sapiens (human): 4804Help
Entry
4804              CDS       T01001                                 

Gene name
NGFR, CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Definition
nerve growth factor receptor
Orthology
K02583  
nerve growth factor receptor (TNFR superfamily member 16)
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Neurotrophin signaling pathway
Transcriptional misregulation in cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21-q22
AA seq 427 aa AA seqDB search
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacacagc
ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcgacc
gagccgtgcaagccgtgcaccgagtgcgtggggctccagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcctgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca
cccccagagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacggtggcaggtgtggtgaccacagtgatgggcagctcccag
cccgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccac
acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacggctctgcgggggacacctggcgg
cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccatgaggcc
tgccccgttcgcgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag
tccactgccacatccccggtgtga

DBGET integrated database retrieval system